KEGG   Alteromonas sp. SN2: ambt_13185Help
Entry
ambt_13185        CDS       T01513                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
alt  Alteromonas sp. SN2
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:alt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ambt_13185
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    ambt_13185
Enzymes [BR:alt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     ambt_13185
Two-component system [BR:alt02022]
 CheA family
  CheA-CheYBV
   ambt_13185
Bacterial motility proteins [BR:alt02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    ambt_13185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2965811..2966941)
Genome map
AA seq 376 aa AA seqDB search
MVFKVLVVDDSTFYRRRVREILDDDRELEVIGEARNGQDALDKIDTLLPDVVTMDVEMPI
MDGISAVKAIMEKRPVPILMFSSLTHHGAQATLDALEAGALDFLPKKFEDIAQDRKDAAR
LLCTKVRLIARRGVGIKRPVLKRIESRKFPDNAPKPAFFKSSNLLSGRKDATRQPTVSSI
KASGKRYKCLAIGASTGGPVALQKILVALPSDFPYPIVLVQHMPGTFTNAFAQRLNSHCD
IAVKEAEHGDILKPGCAYLAPGGKQMLIESSGSHKKVVITDANPSDKINYKPSVDLTFGS
LAKAYGGDLLGIILTGMGADGREGCRLMKDNGATIWAQDQDSCVVYGMPQAVAVANISVN
SIDIDDMSSCILTEMT
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggtctttaaagtcctggtcgtggacgattctactttttatcgtcgtcgagttcgcgag
attctcgacgatgacagagagcttgaagttattggtgaagctcgtaacgggcaagatgca
ctagataaaatagatacactgctacctgatgtagtcacaatggatgtggaaatgccgata
atggatggcatttcagcggtaaaagccattatggaaaaacggcccgtgcctattttgatg
ttttcgtcgcttacgcaccatggtgcacaagcgaccctagatgcgttagaagccggagca
ttagattttctaccaaagaaattcgaagatatcgcccaagaccgtaaagacgcagcacga
ctgctgtgtacaaaagtaagattgattgcacggcgtggtgtcggtataaaacgccctgta
ttaaagcgtattgaaagtaggaagtttcctgataacgcgccgaaaccagcgtttttcaag
agttctaatctacttagcggaaggaaagatgccacgaggcagcccaccgtttcctcgatt
aaggcttctggtaaaaggtataagtgtttagcaattggagcatctacgggtggaccagtg
gcattgcagaagatactggtagcactgccatcagactttccttatccaattgtgttggtg
caacatatgccaggcacttttactaacgcattcgcacagcgacttaattcacattgcgat
attgcggttaaagaagctgaacatggtgacatattgaaaccaggttgcgcttatttagcg
cccggcggtaaacaaatgttgatagagagttcaggctctcataagaaagtagtaattacc
gacgctaacccgtctgataaaataaactataagccgagtgttgatttaaccttcggttcg
ctggccaaagcttatggtggcgatttattgggtattatattaactggtatgggtgcagat
gggcgagaaggttgccggttgatgaaagacaacggtgccactatttgggcgcaagatcag
gattcatgtgttgtttatggcatgcctcaagcggtagctgttgcaaacatatcggttaac
agtattgatatagatgatatgagcagctgtatcttaaccgaaatgacatag

DBGET integrated database retrieval system