KEGG   Alteromonas sp. SN2: ambt_13830Help
Entry
ambt_13830        CDS       T01513                                 

Definition
putative glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
alt  Alteromonas sp. SN2
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ambt_13830
   00052 Galactose metabolism
    ambt_13830
   00500 Starch and sucrose metabolism
    ambt_13830
   00520 Amino sugar and nucleotide sugar metabolism
    ambt_13830
Enzymes [BR:alt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ambt_13830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3122373..3123266)
Genome map
AA seq 297 aa AA seqDB search
MSQVKKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVKECVAAGIKEIILVTHAS
KNSIENHFDTSFELEATLEKRVKRQILEEVQSICPKDVTIMHIRQGVANGLGHAVLCARP
IIGDAPFAVVLPDVIIDDAASDPKKDNLADMVAKFNTTRVSQVMVEQVPQEDVTKFGIAD
LDGAAIEPGESAKIHKMVEKPALDEAPSDLAVVGRYVLSEKIWDLLEFTPPGAGDEIQLT
DAIDALMKVEQVDAYYMKGKSHDCGSKLGYMKANVEYALRHPALGQEFKEYIASLSI
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagtaaagaaagccgttattccagttgcgggtctaggtacccgaatgcttcct
gctacaaaagcaattcctaaggaaatgcttccagtggtagataagccacttattcaatat
gttgtgaaagaatgtgtcgcagcagggataaaagaaattatattggtaacccacgctagt
aagaacagtattgaaaaccatttcgatacgtcttttgagcttgaagccacattggaaaag
cgtgttaagcgtcagatacttgaagaagtacagtcaatttgtccgaaagatgtcaccatc
atgcatatacgccaaggtgtagcgaatggtctcggtcacgctgtattgtgtgcccgtcct
atcattggtgatgcaccttttgcggtagtattacccgatgtgattattgacgatgcagca
agtgatccgaaaaaagataaccttgcagacatggttgctaagtttaataccacccgtgtt
agccaagttatggtcgagcaagttcctcaagaagatgtaactaaatttggtattgctgac
cttgatggcgccgcaattgagcccggtgagtctgcgaaaatccacaaaatggtagaaaaa
cctgcgcttgatgaagcaccgtctgatttagctgtcgtgggtcgttacgtgctatctgag
aagatttgggacttactagagttcactcctcctggtgccggcgatgaaattcaacttaca
gatgctatcgatgcattaatgaaggttgaacaggttgacgcttactacatgaaaggtaag
agccatgattgtggtagtaaactaggttacatgaaagctaacgtagagtacgcgcttaga
cacccagcgttaggccaagaatttaaagagtatattgctagtcttagcatctag

DBGET integrated database retrieval system