KEGG   Alteromonas sp. SN2: ambt_14540Help
Entry
ambt_14540        CDS       T01513                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
alt  Alteromonas sp. SN2
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ambt_14540
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ambt_14540
Enzymes [BR:alt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     ambt_14540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3287498..3288760)
Genome map
AA seq 420 aa AA seqDB search
MDKLVIKKGPALQGTVRISGAKNAALPLLMTSLLSDQPCRYTNVPRLRDINTTVALLREL
GVEVAQPAANDVVLDSSTLQSITASYELVRTMRASILVLGPLLAKQGKANVSLPGGCAIG
ARPVNLHLTGLEKMGAKIEVDEGYIRAEVDGRLKGARIFMDMVSVGATENLMMAAALADG
TTVLENAAREPEIVDLANCLIQMGAVISGAGTDKITIEGVETLNGCDYRVLPDRIETGTF
LVAAAVTGGKIRCTHAAPETLEAVIDKLEQAGAVITLGEDWIELDMQGKQPKAVRVKTAP
HPAFPTDMQAQFVTLNCVAEGTGVITETIFENRFMHVPELQRMGAEIALEGNSAVSKGSS
ALKGAPVMATDLRASASLVIAGLIADGETHVNRIYHLDRGYEAIEEKLGALGANIERVKE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggataaacttgttataaagaaaggccctgcactacagggaaccgtgcgtatttccggt
gctaagaatgctgcgttaccactactaatgaccagtttgcttagcgaccagccatgtcgt
tataccaacgtgcctcgactgcgtgatattaataccacagtagcactactacgagagcta
ggcgttgaagtagcacaacctgctgcgaacgacgtggtgttagactcaagtacgctgcaa
agcattacagcttcatatgaattagtacgtaccatgcgtgcctctattttggtgttaggc
cctttgcttgcaaagcaaggtaaagcaaacgtatcacttcctggcggctgcgcgataggt
gcacgccctgttaatcttcatttgactggccttgaaaagatgggcgctaaaattgaagta
gacgaagggtatattcgcgctgaagtcgatggccgtttaaaaggtgctcgcatcttcatg
gacatggtgagcgttggtgctactgaaaacctaatgatggcagcggcgttggcagacggc
acaaccgtgctagaaaacgccgcacgtgagcctgagattgtcgatttagctaactgtctt
attcagatgggcgcggttatttctggcgcaggtactgataaaattacgattgaaggggta
gaaaccctaaatggttgtgactatcgtgtactgccagatcgtattgaaactggtactttc
ttagttgctgctgcggtaactggcggaaaaattcgttgtactcacgctgcacctgaaacg
ttagaagctgttatcgataagcttgaacaagccggtgcggttatcactttaggtgaagac
tggattgagctagacatgcaaggcaagcagcctaaagcggttcgcgttaaaaccgcacca
caccctgcatttcctacagacatgcaagcccagttcgttacattaaactgcgtagcggaa
ggcacaggtgttattaccgaaacgatatttgaaaaccgttttatgcacgtgccagagcta
caacgcatgggcgctgaaattgcccttgaaggtaactctgcggtttctaaagggagttct
gcgcttaagggcgcacctgtaatggcaaccgatttacgtgcatctgcaagcttagtgatt
gctgggcttattgccgatggcgaaacccatgtaaaccgtatctatcacttagatcgcggt
tatgaagccattgaagagaagttaggtgcacttggcgccaacatcgagcgtgtaaaagaa
taa

DBGET integrated database retrieval system