KEGG   Alteromonas naphthalenivorans: ambt_14540Help
Entry
ambt_14540        CDS       T01513                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
alt  Alteromonas naphthalenivorans
Pathway
alt00520  Amino sugar and nucleotide sugar metabolism
alt00550  Peptidoglycan biosynthesis
alt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ambt_14540
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ambt_14540
Enzymes [BR:alt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     ambt_14540
Peptidoglycan biosynthesis and degradation proteins [BR:alt01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   ambt_14540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase Inj_translocase
Motif
Other DBs
NCBI-ProteinID: AEF04422
UniProt: F5Z4T5
Position
complement(3287498..3288760)
Genome map
AA seq 420 aa AA seqDB search
MDKLVIKKGPALQGTVRISGAKNAALPLLMTSLLSDQPCRYTNVPRLRDINTTVALLREL
GVEVAQPAANDVVLDSSTLQSITASYELVRTMRASILVLGPLLAKQGKANVSLPGGCAIG
ARPVNLHLTGLEKMGAKIEVDEGYIRAEVDGRLKGARIFMDMVSVGATENLMMAAALADG
TTVLENAAREPEIVDLANCLIQMGAVISGAGTDKITIEGVETLNGCDYRVLPDRIETGTF
LVAAAVTGGKIRCTHAAPETLEAVIDKLEQAGAVITLGEDWIELDMQGKQPKAVRVKTAP
HPAFPTDMQAQFVTLNCVAEGTGVITETIFENRFMHVPELQRMGAEIALEGNSAVSKGSS
ALKGAPVMATDLRASASLVIAGLIADGETHVNRIYHLDRGYEAIEEKLGALGANIERVKE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggataaacttgttataaagaaaggccctgcactacagggaaccgtgcgtatttccggt
gctaagaatgctgcgttaccactactaatgaccagtttgcttagcgaccagccatgtcgt
tataccaacgtgcctcgactgcgtgatattaataccacagtagcactactacgagagcta
ggcgttgaagtagcacaacctgctgcgaacgacgtggtgttagactcaagtacgctgcaa
agcattacagcttcatatgaattagtacgtaccatgcgtgcctctattttggtgttaggc
cctttgcttgcaaagcaaggtaaagcaaacgtatcacttcctggcggctgcgcgataggt
gcacgccctgttaatcttcatttgactggccttgaaaagatgggcgctaaaattgaagta
gacgaagggtatattcgcgctgaagtcgatggccgtttaaaaggtgctcgcatcttcatg
gacatggtgagcgttggtgctactgaaaacctaatgatggcagcggcgttggcagacggc
acaaccgtgctagaaaacgccgcacgtgagcctgagattgtcgatttagctaactgtctt
attcagatgggcgcggttatttctggcgcaggtactgataaaattacgattgaaggggta
gaaaccctaaatggttgtgactatcgtgtactgccagatcgtattgaaactggtactttc
ttagttgctgctgcggtaactggcggaaaaattcgttgtactcacgctgcacctgaaacg
ttagaagctgttatcgataagcttgaacaagccggtgcggttatcactttaggtgaagac
tggattgagctagacatgcaaggcaagcagcctaaagcggttcgcgttaaaaccgcacca
caccctgcatttcctacagacatgcaagcccagttcgttacattaaactgcgtagcggaa
ggcacaggtgttattaccgaaacgatatttgaaaaccgttttatgcacgtgccagagcta
caacgcatgggcgctgaaattgcccttgaaggtaactctgcggtttctaaagggagttct
gcgcttaagggcgcacctgtaatggcaaccgatttacgtgcatctgcaagcttagtgatt
gctgggcttattgccgatggcgaaacccatgtaaaccgtatctatcacttagatcgcggt
tatgaagccattgaagagaagttaggtgcacttggcgccaacatcgagcgtgtaaaagaa
taa

DBGET integrated database retrieval system