KEGG   Alteromonas sp. SN2: ambt_14770Help
Entry
ambt_14770        CDS       T01513                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
alt  Alteromonas sp. SN2
Brite
Enzymes [BR:alt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ambt_14770
Secretion system [BR:alt02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ambt_14770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3329399..3330121)
Genome map
AA seq 240 aa AA seqDB search
MKVVKFSLLVAMVFTTSLFASAASAADETAIKSKLTNMLGLEVDSLADSPIPGLVQVSTN
RGFFYVSDDAKYLVQARILNIDEGMRNETEAAYSDLRIEGVKEMESSAITFKAKNEKHVI
SVFTDTTCGYCRKLHKEVGDLNDLGITVNYLAFPRAGLDSQNYQDMVSVWCAANPQKALT
DAKAGNDVATAKCANKVAEQYLLGQKLGVNGTPNIVLPDGSLIPGYQPAGMIAQAIEQAE
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtagtaaaatttagcttattggttgcaatggtgttcactacgagccttttcgcg
agtgccgcaagcgcagcagatgaaacggcaattaagagtaagctgactaatatgctgggg
ctagaggttgactctcttgctgattcacccattccaggcttggtacaagtatcgaccaat
cgcggtttcttctatgtcagtgatgatgctaaatatttggttcaggcgcgtattctcaat
atagatgaaggcatgcgtaatgaaaccgaagccgcctattcggaccttcgcatcgaaggt
gtgaaggaaatggaatcatcagccattacgtttaaagctaaaaacgaaaagcatgtgatc
agtgttttcaccgataccacttgtggttattgtcgcaagcttcataaagaagtgggcgac
ttaaacgacttggggattacggtaaactacttggcttttcctcgtgcagggttagacagc
cagaattaccaagatatggtgtcggtatggtgtgcagcaaatccgcaaaaagcattaact
gatgcaaaagcgggcaacgatgtggcaaccgctaaatgtgctaacaaagtggcagagcaa
tatttgttgggacaaaaactaggtgtaaacggtacccctaacattgtattgccagatggc
tcgctaattccaggttaccaacctgcaggtatgattgcacaggctattgagcaagccgaa
tag

DBGET integrated database retrieval system