KEGG   Alteromonas sp. SN2: ambt_15285Help
Entry
ambt_15285        CDS       T01513                                 

Definition
hypothetical protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
alt  Alteromonas sp. SN2
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:alt02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:alt02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3454115..3458617)
Genome map
AA seq 1500 aa AA seqDB search
MESLPSSRATKPEIAPFIVGVGSSAGGIEALINLVSELPKAINASFIIAQHLSPTHKSQM
TEILARETEYPVVEATPHCKIKANTIYVGPPGYHLKYKEGYLHLDKSPDELSPKPSVNLL
FESLADEIGDHAIGVILSGTGSDGARGLKAIKGVGGFAFVQDPASAKYDGMPKAALENVA
VDSILEPQEMGQEIAHISQNIARNFLAVQEDTRSELMSELYGKIRTATKIDFSFYKQSTL
LRRVNRRLIATQTEDLPSYLTYLDNNADEVIALSKELLISVTDFFRDNTAFNAIKTHIES
IVENKNSGDAIRLWVAGCATGEEAYSLAILFLEAIEKQGIDANLQIFATDIDEHALSVAR
KGAYSVQAIASLSSDLTDKYFRYADNAYYPQKLLRDVITFSRQDITRDPPFLHLDMVSFR
NVLIYFNSDLQQRVLSLFRYSLTKEGILFLGKSESIGSTEDIFVALDRRSRIFKVSEASK
PPSLPKMLKSHVDITKTKTAITNSYENIFTRSVLDSFGPSLLISERFAILHSHGNLQRFI
TFPSGVPDLNLSKLIAAPFAADLISCVNKASRTGEIAISRAKRLADDDSRLWKLRVLPLE
NQSPQHYLVNFYEYDTIIDAEPKEPTATNEADVAELIAAREQLQTLTEEMAASAEEMQAL
NEEVQAANEELQANNEELEATNEELQATNEELISVNEESMRKSADLGAINSELMSVYNTL
DFPILVFDTDTCLSRTNDAANRRFHLNNGSFKKPMYSLNFPGYFEDIEKRLSKTLRNGVN
TSMVIKPSSQETYNVFITPILNSRERITGAVLVIIDNSELVIAHERIEKSQEQLLSIMNN
SLALIALKDNAGRYEFVNARFEEVFGVTAQDVIGKTDLQIFERDTARQFREKDLDTMRTL
SPVETLDEFTLRAGKVIIKSVRFPIFDAEGTIKSICTQATDISKELHANEQLRLAGKIFE
RTSEAILVTDANQRILTTNETFAELTGFSQQELIGKKPELLESGEHSKDFFAAMDASLTE
RGFWQGEVINKVKDGSHVKMWLSYNAVKDANGDIVNYVAAYSNIDEIKNMQRRIEYLATH
DELTGLPNRTVLLERLELMISGAKRSKQLCGVLFVDLDNFKPVNDNLGHKVGDLLLKQVT
KRLQQCIRDTDMLARIGGDEFVALISASHIDEIDDIAKRIISQVQNEFDVSTHSISVSAS
IGIAVYPADGISSEILLQHADEAMYLAKSSGRNQYQYFTAKMKEQALARLEVEKQLKVAL
DGKQFSMVYQPQFEPTSNAIVGAEALLRYKNSDGEVLNAESFINIAERGKLIETIGFHAV
ELVAREIAQYIQLGSKLPAIAINLSGSQLLTSDFIKNFVAVLDRYELTPGLFKFEVSEKD
IESGEERIYHRLRTLASMGSVISIDDYGLYKSAISQLQQSGASEIKLSSRLLTDVSDNND
SNKLIHALINAGKALGLKIIADKVETQQQLDYLRDIGCDVVQGLVFSPMLTCAELNKQIS
NT seq 4503 nt NT seq  +upstreamnt  +downstreamnt
atggaatctttaccgtcatcgcgggcgactaaacctgagatagctccttttattgttggc
gtaggctcttcagcgggcggaatagaagcattaatcaatctggtaagcgaattaccaaaa
gccatcaatgcgtcttttattattgctcagcatttatctcctactcataaaagccaaatg
acggaaatattggcgcgagaaactgaataccctgtggttgaggctacgccgcattgcaaa
attaaagcaaacaccatttatgtggggccaccgggttaccaccttaaatacaaagagggg
tatttacacctcgataaatcaccggatgaactatctcctaagccctccgttaacctcttg
tttgaatcattagctgatgaaattggcgatcacgcaattggcgttatcttatcgggtact
ggcagcgatggtgccagagggcttaaggccattaaaggtgtcggtgggtttgcctttgtg
caagacccagcctctgcaaaatatgatggcatgcccaaagcggcgcttgaaaatgtggct
gtggattcaattcttgaaccccaagaaatggggcaagaaattgcacatatttcgcaaaac
atcgcgcgtaatttcttagcggtgcaggaagacactcgaagtgaattaatgagtgaactc
tacggaaagataagaacggcgaccaaaatagatttcagtttttacaaacaatcgaccttg
ttgcgcagagtgaatcgtcgtttaattgccacacaaactgaagatttaccctcttatttg
acctatttagacaataacgccgatgaagttatagcattgtcgaaagagctattaatttca
gttaccgactttttcagagacaacactgcatttaacgctatcaagacacatattgagagt
attgtagaaaacaaaaacagcggcgatgctattcgtttatgggtagcaggatgtgccact
ggagaagaggcatactcattagccatcttgtttcttgaagctattgagaagcaaggtatt
gatgccaacttgcagatttttgcgactgatatcgatgaacatgcactctcagttgcccgc
aaaggggcctattctgttcaggccattgcaagcctttcatcggatttaaccgacaagtac
tttcggtatgctgacaatgcgtattacccgcaaaaattactgcgtgatgtaatcaccttt
tctcgtcaggacatcacgcgagatccgccatttttacaccttgacatggtgtcgtttaga
aatgtacttatctactttaatagcgatttacagcagcgggtgttatcgctgtttcgttat
tcgttaaccaaagaaggtattctctttttaggtaagtctgaatcgattggctcgacagaa
gatatctttgttgcccttgataggcgcagtagaatttttaaagtaagcgaggcgtctaag
cctccctcactgccgaaaatgctaaaaagccatgtagatataactaaaacgaaaacggct
atcactaacagctacgaaaatattttcactcgctctgtactagatagcttcgggccaagt
ttactcatcagtgaaaggtttgccattttgcactcacatggcaacttacaacgctttatt
acgttcccatctggggtgcccgatcttaacttatcgaaactcattgctgcgccttttgcc
gcagacttgatttcttgcgtgaataaggcaagtcgtactggtgaaatagcaataagtcga
gctaagcgcttagccgacgatgatagtcggctgtggaagttacgggtgctcccgctagaa
aaccaaagtcctcagcactacttagttaatttttatgaatacgacactattattgatgcc
gagcccaaagagccgacggcaaccaatgaagctgatgttgctgaattaattgcagctcga
gagcaactacaaacgcttaccgaagaaatggctgcctcagcggaagaaatgcaggcactt
aatgaagaagtgcaagccgctaacgaagagctacaagcgaataacgaagagcttgaagcc
accaacgaagagcttcaggctactaacgaagaactcattagcgtaaatgaagaaagcatg
cggaaatctgctgatttaggtgcgataaacagtgagttgatgagcgtttacaacacgtta
gattttccaatcttggtctttgataccgatacctgcttaagtcgaaccaatgacgcagcc
aatcgccgttttcatttaaataatggctcgtttaaaaagccgatgtactcgcttaatttc
cccggctattttgaagacattgaaaagcgcttaagtaaaaccctgcgtaatggggtaaat
acgagcatggtgatcaagccatcaagccaagaaacttacaatgtattcattacgccaatt
ctaaacagtcgagagcgcatcactggggctgttctagttattattgataactcagaattg
gtcattgcccacgaacgaattgaaaaaagccaagagcagcttttatctattatgaataac
tcattggcgttaattgcacttaaagataatgcgggtcgatatgagtttgtgaacgctcgg
tttgaagaagtctttggcgtaaccgcgcaagatgtgattggcaaaactgatcttcaaatt
tttgagcgtgatactgcccgtcagttccgtgaaaaagacttagatacaatgcgtactttg
tcaccggtagaaacccttgatgagttcaccttgcgggccggtaaagttattatcaaaagt
gtgcgattccctatttttgatgccgaaggcaccataaagtcaatttgtacccaagcaaca
gatatttcaaaagagctacatgccaatgaacaattgcgtttagctggcaagatatttgag
cgtaccagtgaagctattcttgttactgatgccaatcagcgcattcttaccactaacgag
acatttgctgaattaacaggcttttctcagcaggagttgattggcaaaaaaccagagctg
ttagagtcgggtgagcattcaaaagacttttttgcagcaatggatgcgtcgttgacagag
agagggttttggcaaggcgaagtcattaacaaagtgaaagatggtagtcatgtgaaaatg
tggctttcatataatgcggtaaaagacgcaaatggtgacattgttaattatgttgcggcc
tacagcaatattgatgagataaaaaatatgcagcgccgcattgaatatctcgctacccat
gacgagctgacaggtctacccaatagaaccgtgttacttgaacgtcttgaactcatgatt
agtggggcgaagcgtagcaagcaattatgcggtgtactctttgttgacttagataacttt
aagccggttaacgacaacttaggtcataaggtgggtgacttgctccttaagcaggttact
aagcgactacaacaatgtatacgcgacacagatatgttggcgagaattggcggtgatgaa
tttgtagccttaatatcggcctctcacattgacgaaattgatgatattgcaaagcgtatc
attagtcaggttcaaaacgagtttgatgtatctacccattctatttcggtttctgcgagc
atcggtattgccgtttaccctgcagatgggatcagctcagaaatactcttgcagcacgca
gatgaagccatgtatttagcgaaatcttctggtcgcaatcaatatcagtactttaccgcg
aagatgaaagagcaggcattagcccgtttagaagtcgaaaaacagcttaaagtagcatta
gatggtaaacagttttcaatggtgtaccaacctcagtttgagcctacgtcgaacgccata
gttggcgccgaggcattactgcgttataaaaatagcgacggtgaagtacttaatgctgag
tcatttattaatattgccgagcgcggaaaactgattgaaaccataggctttcatgcggtt
gagttggttgcgcgagaaattgctcaatatattcaacttggcagtaaactgcccgccata
gcgattaatttatctggatcgcagttgcttacatctgattttattaaaaactttgtggca
gtactagaccgttatgaacttaccccgggtctatttaaattcgaagtatctgaaaaagat
attgaaagtggtgaagagcgaatttaccatcggttgaggacattggcctcgatgggcagt
gtgattagtattgacgactatggcctgtacaagagtgcaatatctcagcttcaacaaagc
ggagcgagtgaaattaagctatccagccgattattgaccgacgttagcgataacaatgat
tcaaacaaacttattcacgctttgattaatgcaggaaaagcactaggccttaaaatcatc
gcggataaagttgaaactcagcagcaactcgattacttacgggatatcgggtgcgatgta
gtacaggggcttgttttttcgcctatgcttacatgcgcagagcttaataaacaaattagt
taa

DBGET integrated database retrieval system