KEGG   Alteromonas sp. SN2: ambt_15500Help
Entry
ambt_15500        CDS       T01513                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
alt  Alteromonas sp. SN2
Brite
Enzymes [BR:alt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     ambt_15500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3515936..3516571
Genome map
AA seq 211 aa AA seqDB search
MRASRKGDALAQLLYDEGIRSQPVLNAIAGTPRDTFLPDALKHKAYQNTALPIGQGQTIS
QPYIVAKMTELLLDSPNKPEKVLEIGTGSGYQTAILAQLFSAVFSVERIKSLQFHAKRRM
NQLDLHNIAMKHGDGWKGWTSKGPYDAIIVTAAASSLPQDLCDQLKEGGRLIIPVGNEQQ
SLLCIDRIEGELKTTTIEAVRFVPLVAGELL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgagagcctccagaaaaggggatgcgctagcacagctgctttatgacgaagggatccgt
tcgcagcctgtgcttaacgccattgccggtacaccccgggacacattcttacctgatgcg
cttaagcataaagcctatcagaatactgcgctgcctattgggcaggggcagaccatttcg
caaccctatattgttgcgaaaatgaccgaactgctgctagatagtccgaataaaccagaa
aaagtgttagagattggtaccggctctggttatcagaccgctattcttgcacagcttttt
tcggcggtattcagcgtagaacgaatcaaatcgctacaatttcatgccaaaagacggatg
aaccaactcgatttacataatattgccatgaagcatggtgatggatggaaagggtggaca
tctaaaggtccttacgatgccattattgtgacggctgcggccagtagtttgccgcaagat
ttatgcgatcaattaaaagaaggaggccgcctgatcattcccgtaggaaatgaacagcag
tctctattgtgtatcgacaggatagaaggcgagctaaaaaccaccacaatagaggcggtg
cgttttgttcccttagtagcaggagagctattgtga

DBGET integrated database retrieval system