KEGG   Alteromonas naphthalenivorans: ambt_15565Help
Entry
ambt_15565        CDS       T01513                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
alt  Alteromonas naphthalenivorans
Pathway
alt00071  Fatty acid degradation
alt00280  Valine, leucine and isoleucine degradation
alt00281  Geraniol degradation
alt00310  Lysine degradation
alt00362  Benzoate degradation
alt00380  Tryptophan metabolism
alt00410  beta-Alanine metabolism
alt00640  Propanoate metabolism
alt00650  Butanoate metabolism
alt00903  Limonene and pinene degradation
alt00930  Caprolactam degradation
alt01040  Biosynthesis of unsaturated fatty acids
alt01100  Metabolic pathways
alt01110  Biosynthesis of secondary metabolites
alt01120  Microbial metabolism in diverse environments
alt01130  Biosynthesis of antibiotics
alt01200  Carbon metabolism
alt01212  Fatty acid metabolism
Module
alt_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ambt_15565 (fadB)
   00650 Butanoate metabolism
    ambt_15565 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    ambt_15565 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    ambt_15565 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ambt_15565 (fadB)
   00310 Lysine degradation
    ambt_15565 (fadB)
   00380 Tryptophan metabolism
    ambt_15565 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ambt_15565 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ambt_15565 (fadB)
   00281 Geraniol degradation
    ambt_15565 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ambt_15565 (fadB)
   00930 Caprolactam degradation
    ambt_15565 (fadB)
Enzymes [BR:alt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ambt_15565 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ambt_15565 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ambt_15565 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     ambt_15565 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AEF04623
UniProt: F5ZES3
Position
3529210..3531360
Genome map
AA seq 716 aa AA seqDB search
MIYTGKSLSVSLLDDGFAELVFDAEGSVNKFDRQTVTELDEATQALLKESGVKGLVVRSA
KSAFIVGADITEFTGLFAMDEAEVLNWVANTSQVFDRFEDLPFPTVAAINGFALGGGCEM
TLACDLRVADTTASIGLPEVKLGIMPGFGGTVRLPRLIGADNALEWMTTGKDRKGAKALA
EGAVDAVVAPESLRDSALSMLKDAADGKFKWEARRAQKKAPLQLNKNEAMMSFSTAQAMV
FAQAGKHYPAPHKMVETVQKAAGLDRDGALKLENAGFVALTKTDAAQAQIGIFLADQLVR
SKGKKQAKAATKEVKLNAVLGAGIMGGGIAYQSAVKGMPVIMKDINTEALDLGLNEAANI
LGKGMQRGKVDAKTMAKTLNAITPTLDYNTLKDADLVIEAVVENPKVKGIVLKEVEDVVA
DDAIICSNTSTISINQLAKSLDKPERFCGMHFFNPVHRMPLVEIIRGENTSEDTINAVVA
TTLRMGKTPIVVNDCPGFLVNRVLFPYFAGFSKLLIDGADFVAVDKVMEKQFGWPMGPAY
LMDVVGIDTGDHAADVMAAGIPERMARIGDDPVTVLYKEKRLGQKNGKGFYNYGKDKRGK
PTKVAAEEAYSLLAPITADTKDFDAQDIIARLMIPMANEAIRCLEEGIVGTAAEADMALL
YGLGFPPFRGGVFRWIETMGLANFVELADKYASLGPIYQISDGVRKMAAEGKSYFA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatatacacaggcaagagtttatccgtcagtctgttagatgatggctttgctgaactg
gtatttgatgccgaaggttcagtaaacaagttcgaccgccaaacggtgacagaacttgat
gaagcaacccaagcattgcttaaagaaagcggtgttaaaggcttagtagtacgcagcgca
aaatctgcatttattgtaggtgctgatatcaccgaatttaccggcttattcgcgatggat
gaagccgaagtactaaactgggtagcaaacacgtctcaggtgtttgaccgcttcgaagat
ttgcctttccctaccgttgctgccattaacggttttgcattgggtggtggctgtgaaatg
acactagcctgtgaccttcgcgttgcagatacaactgcctctattggcctaccagaagtt
aaattaggcataatgcctggctttggtggcaccgtacgtttacctcgcttaattggtgcc
gacaatgcactagagtggatgaccacaggtaaagacagaaaaggcgcaaaagcccttgct
gaaggcgccgttgacgccgtagttgcaccagagtcattacgcgacagcgcactttctatg
ctaaaagatgccgcagatggcaagttcaaatgggaagcacgtcgtgctcagaagaaagcc
ccattacagctaaataaaaacgaagctatgatgagtttttctaccgcacaagccatggta
tttgcccaagcaggcaagcactaccctgctccgcacaaaatggtagaaaccgttcaaaaa
gccgcaggccttgaccgcgatggcgcacttaagcttgaaaacgctggctttgttgcccta
actaaaaccgatgcagcgcaagcgcaaattggtattttcctagccgaccagctagtaaga
agtaaaggtaagaaacaagctaaagctgccacaaaagaggtaaaacttaatgccgtactg
ggtgcgggcattatgggtggcggtattgcgtatcaaagtgctgttaaaggcatgccagtg
atcatgaaagacattaacactgaagcactagacctaggcttaaacgaagctgccaatatt
cttggtaaaggtatgcagcgcggtaaagttgatgccaaaaccatggcaaaaacccttaac
gctattacgcctacccttgactacaacacgcttaaagatgcagatcttgtgattgaagcc
gttgttgaaaacccgaaagtaaaaggcatagtgcttaaagaagtagaagacgtagtggcc
gatgacgctatcatctgttctaacacctctactatttcaattaaccaattagcgaaaagc
ttagacaagccagaacgcttctgtggtatgcacttctttaacccagtacaccgcatgcca
ttggttgaaattattcgtggtgaaaatacctcggaagatactattaatgccgtagtggcc
accacacttcgcatgggtaaaaccccaattgtggttaacgattgcccagggttcttggta
aaccgcgtattgttcccttacttcgcaggcttcagtaagttgctaatagatggcgctgat
tttgttgctgttgataaagtaatggaaaaacagttcggctggccaatgggccccgcttac
ctaatggatgttgttggtattgatactggcgaccacgctgcagacgttatggcagcaggt
attccagagcgtatggcacgtattggcgacgacccagtaaccgtgctttataaagaaaaa
cgcttaggccagaaaaatggcaaaggcttttataactacggtaaagacaagcgcggtaag
cctacgaaagtggctgctgaagaagcatacagcttgcttgctcctattacagccgatacc
aaagacttcgacgcgcaagacattattgcacgcttgatgatccctatggctaacgaagca
attcgttgcctagaagaaggcattgtaggtactgcagctgaagcagatatggccttactt
tacggtttaggcttccctccattccgcggtggtgtattccgctggattgaaacaatggga
ttagcgaactttgtcgaactagccgacaaatacgccagtcttggcccgatttaccaaatt
tcagatggcgttcgcaagatggccgctgaaggtaaatcttacttcgcttaa

DBGET integrated database retrieval system