KEGG   Alteromonas sp. SN2: ambt_16035Help
Entry
ambt_16035        CDS       T01513                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
alt  Alteromonas sp. SN2
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ambt_16035
Enzymes [BR:alt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ambt_16035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3618904..3619869)
Genome map
AA seq 321 aa AA seqDB search
MSWTFTSEQDLASTFATEINPFWQTSVTLGEFVGKDNIDVHYAWCIPENPKSTVVISSGR
IESYLKYKELIFDLYQNGFAVFILDHRGQGLSGRMTHDPQHGYVADFADYVDDLITFVND
IVKPRQQGELQLLCHSMGGAIGALTLLRDPSLFDKAVLASPMFGIKPALPNWLANSLIKV
GLSINKMKKRESGYFFGQTPYIAFPYALNKLTHSKNRYSLFRQLYDEERQIQLGGVTTEW
LRAAQAAMNTIELNAAAITTRSLILSADGDSIIENKRQRRVAAKFPNAQVEIIPVAYHEV
LTESDDIRDAALSTVFDFLSA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagctggacgtttacgtcagagcaagacttagcttcgacctttgccactgaaataaac
cctttttggcaaacttctgtcacccttggcgagtttgttggtaaagataacatcgatgtg
cattacgcgtggtgcataccagaaaaccccaaatccacggtggtgatcagttcagggcgt
atcgagtcctacttaaaatacaaagaactcattttcgatttgtatcaaaatggctttgca
gtttttattcttgatcaccgagggcaagggttatcggggcgtatgactcacgatcctcaa
catggatacgtggcggatttcgccgattacgtggatgatttaatcaccttcgtaaacgat
attgtgaagccgcgccaacagggtgagttgcagttactttgccattctatgggcggcgca
attggcgcactaaccctattaagagaccctagcttattcgacaaagcagtacttgcatcc
ccgatgttcggtattaagcctgcactaccaaattggttggccaatagccttataaaagta
gggcttagtattaataaaatgaaaaagcgtgagtcaggttatttctttgggcaaacgcct
tacattgcatttccttatgccttaaataaacttacgcatagtaagaatcgctacagctta
tttcgccagctttatgatgaagagcgccaaattcaacttggtggtgtaaccactgaatgg
ttgcgggcagcacaagccgccatgaataccattgaacttaatgcggccgctattactacg
cgctcgttaattttaagtgcagatggcgacagtattatagagaacaaacgccaacgtcgc
gtagccgctaagttccccaatgctcaggtagaaattattcctgtggcgtatcatgaggtg
cttaccgaatcggacgacattcgtgatgctgcactttctactgtatttgattttttaagc
gcgtaa

DBGET integrated database retrieval system