KEGG   Alteromonas sp. SN2: ambt_16300Help
Entry
ambt_16300        CDS       T01513                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
alt  Alteromonas sp. SN2
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:alt00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:alt00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3681139..3682170
Genome map
AA seq 343 aa AA seqDB search
MSDFTGNHILSVNQFDREAIEKVFSVADSMQPYAKRQKRTTVLEGAILGNLFFEPSTRTR
VSFGTAFNLLGGEVRETTGMASSALAKGESLYDTARVLSGYSDIIAMRHPAAGSVAEFAE
GSRVPVINGGDGANEHPTQALLDLFTIKRELEYHGHGIDGLHIAMIGDLRYGRTVHSLSR
LLCLFKNVRFTLISPKELAMPQPIIDAIENAGHQLNITETFEGSLDADICYQTRIQEERF
PSQEEANKYRGKFRLNHSIYTRHFQSKTVIMHPLPRDSRIEANELDNDLNLNPNLAIFRQ
TDNGVLVRMALFALTLGVEELLTKYEREVVWFSNKSNELHAKI
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtctgactttaccggtaatcatattctttcggttaatcaattcgatcgtgaggctatt
gagaaagtattctcagttgctgattccatgcagccctatgcgaaacgccaaaagcgcact
actgtgcttgaaggcgccatccttggtaatttatttttcgaacctagcacccggactcgc
gtcagtttcggcaccgcgtttaaccttttaggtggtgaagtgcgtgaaaccaccggcatg
gccagttcagccttagcgaaaggcgaatcactttatgataccgcccgtgtactgagcggt
tactcagatattattgccatgcgtcaccctgctgcgggatcggtagccgagtttgcagaa
ggcagtcgtgtaccagtgattaacggtggtgacggtgctaatgaacaccccactcaagcc
ttactcgatttatttaccattaaacgtgaattggaataccatggccatggtattgatggt
ttgcatatcgcaatgattggcgaccttcgttacggtagaaccgtacactcgttgtctcgc
cttttatgcttattcaaaaatgtgcgcttcacgctaatatcgcctaaagaattagccatg
ccacagccaattatcgatgcgattgaaaatgcggggcatcagcttaatataacggaaaca
tttgaaggcagtttagatgccgacatttgttatcaaacccgtattcaggaagagcgtttt
ccttctcaagaagaagccaataaataccgtgggaagttccgtttaaaccactctatttat
actcgccattttcagtccaaaactgtcattatgcatccacttcctcgagattctcgtata
gaggctaacgagctagataacgacctaaatttaaatccaaaccttgccatattcagacaa
accgacaacggcgttctcgtacgcatggcgttatttgcgcttacgttaggcgttgaagag
ttgttgactaaatatgaacgtgaagtggtatggttcagcaacaagagcaatgaattacat
gcaaaaatctga

DBGET integrated database retrieval system