KEGG   Alteromonas sp. SN2: ambt_16300Help
Entry
ambt_16300        CDS       T01513                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
alt  Alteromonas sp. SN2
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ambt_16300
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ambt_16300
Enzymes [BR:alt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     ambt_16300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3681139..3682170
Genome map
AA seq 343 aa AA seqDB search
MSDFTGNHILSVNQFDREAIEKVFSVADSMQPYAKRQKRTTVLEGAILGNLFFEPSTRTR
VSFGTAFNLLGGEVRETTGMASSALAKGESLYDTARVLSGYSDIIAMRHPAAGSVAEFAE
GSRVPVINGGDGANEHPTQALLDLFTIKRELEYHGHGIDGLHIAMIGDLRYGRTVHSLSR
LLCLFKNVRFTLISPKELAMPQPIIDAIENAGHQLNITETFEGSLDADICYQTRIQEERF
PSQEEANKYRGKFRLNHSIYTRHFQSKTVIMHPLPRDSRIEANELDNDLNLNPNLAIFRQ
TDNGVLVRMALFALTLGVEELLTKYEREVVWFSNKSNELHAKI
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtctgactttaccggtaatcatattctttcggttaatcaattcgatcgtgaggctatt
gagaaagtattctcagttgctgattccatgcagccctatgcgaaacgccaaaagcgcact
actgtgcttgaaggcgccatccttggtaatttatttttcgaacctagcacccggactcgc
gtcagtttcggcaccgcgtttaaccttttaggtggtgaagtgcgtgaaaccaccggcatg
gccagttcagccttagcgaaaggcgaatcactttatgataccgcccgtgtactgagcggt
tactcagatattattgccatgcgtcaccctgctgcgggatcggtagccgagtttgcagaa
ggcagtcgtgtaccagtgattaacggtggtgacggtgctaatgaacaccccactcaagcc
ttactcgatttatttaccattaaacgtgaattggaataccatggccatggtattgatggt
ttgcatatcgcaatgattggcgaccttcgttacggtagaaccgtacactcgttgtctcgc
cttttatgcttattcaaaaatgtgcgcttcacgctaatatcgcctaaagaattagccatg
ccacagccaattatcgatgcgattgaaaatgcggggcatcagcttaatataacggaaaca
tttgaaggcagtttagatgccgacatttgttatcaaacccgtattcaggaagagcgtttt
ccttctcaagaagaagccaataaataccgtgggaagttccgtttaaaccactctatttat
actcgccattttcagtccaaaactgtcattatgcatccacttcctcgagattctcgtata
gaggctaacgagctagataacgacctaaatttaaatccaaaccttgccatattcagacaa
accgacaacggcgttctcgtacgcatggcgttatttgcgcttacgttaggcgttgaagag
ttgttgactaaatatgaacgtgaagtggtatggttcagcaacaagagcaatgaattacat
gcaaaaatctga

DBGET integrated database retrieval system