KEGG   Alteromonas sp. SN2: ambt_16565Help
Entry
ambt_16565        CDS       T01513                                 

Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
alt  Alteromonas sp. SN2
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ambt_16565
   01230 Biosynthesis of amino acids
    ambt_16565
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ambt_16565
  Energy metabolism
   00680 Methane metabolism
    ambt_16565
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ambt_16565
Enzymes [BR:alt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ambt_16565
Exosome [BR:alt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ambt_16565
  Exosomal proteins of melanoma cells
   ambt_16565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3739704..3740450
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESQWNLENRFTGWHDVDLTDTGVAQAKTAGQLMKDAGFEFDQAYTSVLLR
AIKTLNISLEEMGQHYLPVERHWRLNERHYGALTGLDKAETAAKHGEEQVKVWRRSFDIP
PPAVDTDSEHFPGVDRRYSNVDAEILPRGESLKMTIERVLPYWHDVIRPDIQAGKRVIIA
AHGNSLRALVKYLDGMSDEDVLSLNIPTGVPLVYELDENLKPISKEYLGDPEAIKAMMDA
VAKQGKAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtataaactggtacttattcgtcatggagaaagtcagtggaaccttgaaaatcgtttc
actggttggcacgacgttgatttaactgacacaggtgtcgcacaagctaaaaccgctggt
cagttaatgaaggacgcaggttttgaattcgatcaggcttacacgtctgtattgcttcgt
gctatcaaaacattgaatatctctttggaagaaatgggtcaacattacctacctgttgaa
cgtcactggcgtttgaacgagcgtcactacggtgcgcttacagggttagacaaagctgaa
acggctgctaagcatggtgaagagcaagttaaagtttggcgtcgtagtttcgatattcca
ccaccagccgtagatactgacagcgaacacttcccaggagtcgatcgtcgttacagcaac
gttgatgccgagattcttcctcgcggtgaaagcttgaagatgaccatcgagcgtgtacta
ccttactggcacgatgttattcgcccagacattcaagctggcaagcgcgttattatcgcg
gctcacggcaacagccttcgtgcattggttaaatacttagatggcatgtctgatgaagac
gtactaagcctaaatattccaactggcgtacctttggtctacgagctagacgaaaacttg
aagcctatctctaaagagtacttgggcgatccagaagcgattaaagcgatgatggatgcc
gttgctaagcaaggcaaagctaagtag

DBGET integrated database retrieval system