KEGG   Alteromonas sp. SN2: ambt_17255Help
Entry
ambt_17255        CDS       T01513                                 

Definition
putative carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
alt  Alteromonas sp. SN2
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    ambt_17255
Enzymes [BR:alt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     ambt_17255
Exosome [BR:alt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ambt_17255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3894900..3896384
Genome map
AA seq 494 aa AA seqDB search
MGQYILAIDQGTTSSRSIIFAADGAIVAVAQQEFSQKYPQDGWVEHDPEEIWESVTTTMK
QVFDKCSVSPEDIASIGITNQRETTLVWNKNTGKPVYPAIVWQDRRTSQQCRELDDDESL
VAHITESTGLLLDPYFSATKLAWILDNVEGARAQAEAGELLFGTVDTFLIWRLTNGESHK
TDATNASRTMLFDINTQCWDERLLDTFNIPKAMLPEVMDCADEFGVVSKDILGCAIPIQG
VAGDQQATLVGQACFQKGMAKSTYGTGCFMILNTGDKPLQSKNRLLTTVGYRLNGKTTYA
LEGSIFMAGATVQWLRDGLKLIDDASETEALAQRARQDNGVFLVPAFTGLGAPYWDPDAR
GAILGLTRDTGISEIVAAGLQSVCYQTKDLQKAMESDGARPTTIRVDGGMSRNDWVMGFL
SDILGAEVERPEITETTALGAAFLAGLQAGVFTSVDSLTECWKSDSIFTPRLSKEERDKA
YDGWKNAVARIRCS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgggccaatatattcttgccatagaccaaggaaccacgagttcacgtagcattatcttt
gcagcggacggcgctatcgtagctgttgcacaacaagagttttctcaaaaatacccacaa
gatggttgggtggaacacgatccagaagaaatttgggaaagcgtaaccactaccatgaag
caagtattcgataagtgctctgtatcacctgaagatatagcctctataggtattaccaat
caacgcgaaacaaccttagtttggaataaaaacaccggcaagcctgtgtacccggctatt
gtttggcaagacagacgtacctcgcagcaatgtcgcgaactcgacgacgatgaaagttta
gtggcgcatattactgaatctacggggctactgcttgacccttatttttcggccaccaaa
ctagcgtggatcttagacaatgtagaaggtgcaagagcgcaagccgaagccggtgaattg
ctttttggtacagtggacaccttcttaatttggcgtttgaccaacggcgaatcacataag
accgatgccactaacgcttctcgtaccatgttgttcgacattaatactcagtgttgggac
gaacgattactcgatacctttaatatccctaaagccatgcttcctgaggtcatggactgt
gctgatgaatttggtgttgtaagcaaagatattttgggctgtgctatccctattcaaggt
gtagccggcgatcagcaggctacgcttgttggccaagcctgcttccagaaaggcatggca
aaaagtacttatggtacgggttgtttcatgattttgaatacaggcgacaagcctcttcaa
tctaagaaccgcttgttaactaccgtaggttataggttaaacggaaaaaccacttacgcc
cttgaaggtagtattttcatggccggcgctacggtgcagtggttacgtgatggcttgaaa
ctgattgacgatgcttccgaaaccgaagcgttggcgcaaagagcgcgacaagataacggt
gtttttcttgtgccagcctttaccggactaggcgctccttattgggatcccgatgcgcga
ggtgcgattttgggcctaactcgagacaccggcataagcgaaattgttgccgcgggcttg
caatcagtatgttatcaaaccaaagacttacagaaagccatggaaagtgatggcgcacgg
ccaaccactatccgcgtagatggcggcatgtctcgaaacgattgggtaatgggtttcttg
tctgacatattaggcgcagaagttgaacgccccgaaattactgaaaccaccgcacttggc
gccgcattccttgctggccttcaagctggtgtatttacctctgttgattcccttaccgag
tgctggaaaagtgacagtattttcactcctcggctttcaaaagaagagcgtgacaaggcc
tatgacggttggaaaaacgccgttgcccgtatccgctgtagttaa

DBGET integrated database retrieval system