KEGG   Alteromonas sp. SN2: ambt_17295Help
Entry
ambt_17295        CDS       T01513                                 

Definition
glycoside hydrolase, clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
alt  Alteromonas sp. SN2
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ambt_17295
  Lipid metabolism
   00561 Glycerolipid metabolism
    ambt_17295
   00600 Sphingolipid metabolism
    ambt_17295
Enzymes [BR:alt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ambt_17295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3903425..3905569
Genome map
AA seq 714 aa AA seqDB search
MSSLTAFVRLDNAKTTLIFDCQGRMPTLIYYGQQLKTATTPDMLALLNTRQEAKCAPVIE
PPISLVPTHGEGVTGSPGLEISGDADQWSAGFTLSDIEQTDTSLTFTAVDADRQMQLITR
VVLDAETTVATFTSSIENQGESTLQLNYLNAASLALPTTMSKIKSFEGRWSNEFQTADHD
LFFGSYVRENRRGKTSHDTFPGLIAFANGTGELVGECFGFHLGASANHKFRAEMMADGRS
YVQFGELLFPGEVTLGAGESYTSPVLYAGFGDAGFSSLSQQFHNFIRNNVLTHSADITSA
QHKPRPVHYNTWEGIYFDHDEATLKALADKVAPLGIERFVLDGGWFKGRRNDKAGLGDWT
VDEAIYPEGLDGLIDHVTDKGMEFGIWFEPEMVNPDSDLYRAHPEWALHTKNNPHVPFRN
QYVLDLTNPEVVEYLYKVITDVLSTYPKISYIKWDMNRDVNHPGNLHGKPAMNGQMAALY
TLIDRVKAAHPGIEIESCCSGGGRVDLGILPHTDRFWTSDSNDALDRLYIQRGFSYFFPS
EVMGAHVGPRDCHITGRNLPIEIRSAVSMFGHMGIEMDPRELTEHEQDTLKSAISLYKKY
RHITHGGDLYRMDDDGLNVKFGYVSKDKAEGIFAYNSVKETGRTTPSRFYFAGLDADKSY
TLERVWPGTLKEYSPSILQKTDGQVFSGEALMKYGMQMPVLFPQTSLIYTAKEV
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcactcacggcttttgtccgcttagacaacgcaaaaacgactttaattttcgac
tgccaagggcgcatgcctactctgatttactatggccagcagttgaagactgcaacgacg
ccagacatgttagcgctgcttaacactcgccaagaagcgaaatgtgcgccggttatcgag
ccacctatctcattagttcccacccatggtgaaggtgttaccggttcacctggtttagaa
atttcaggggatgcagatcaatggtctgctggctttaccttgtcggatattgagcaaacc
gataccagcttaacgtttactgcggttgatgccgacaggcaaatgcagttgattacacgg
gttgtattagatgctgaaacaaccgtggccacatttacctcaagtatcgaaaaccaaggt
gagagcactttacagttaaactacttaaatgctgctagtcttgccttaccaacgaccatg
agcaagattaaaagctttgaaggaagatggtctaatgaattccaaactgccgaccatgac
ttgttcttcggtagttatgtacgtgaaaaccgccgcggcaaaacttctcacgatactttc
ccaggcttaatcgcgtttgctaatggaaccggtgagctagttggtgagtgtttcggcttc
catttaggtgcttcagctaaccataaattccgcgcggaaatgatggctgatggcagaagc
tacgttcaatttggcgaactattgtttccaggtgaagtaaccctcggtgcaggtgaaagt
tatacatcccccgtgctttacgcagggtttggcgacgctggcttttcatccctttcgcag
cagttccataactttattcgaaacaatgtgttaacccacagcgctgatatcaccagtgca
cagcacaagccccgcccagtgcactacaacacatgggaaggcatttatttcgaccatgat
gaagccacgcttaaagcccttgctgacaaagtagcccccttagggatagagcgctttgta
ctagatggcggctggtttaaaggccgaagaaatgacaaagctggcttaggcgactggaca
gtagatgaagccatttacccagaaggactagatgggcttatcgaccacgttaccgataaa
ggcatggaattcggcatatggtttgaacctgaaatggttaacccagatagcgatttgtac
cgcgcacatcctgaatgggcgttacacaccaaaaataacccccatgtaccctttcgtaat
cagtacgtactcgatttaacgaaccctgaagtggttgagtacctttataaagtcatcacc
gacgtactaagcacttaccctaaaattagttacattaagtgggacatgaaccgcgatgta
aatcatcctggcaacctacatggcaaaccagctatgaatggccaaatggcggctttgtat
acgttaatcgatcgcgttaaagcggcacatccgggtattgaaattgaaagctgttgttca
ggcggggggcgtgtggatttaggtatattacctcacaccgaccgtttttggacgtcagac
tctaacgacgcgttagaccgcttgtacatacagcgcggcttctcttacttcttcccttct
gaagtgatgggcgcacacgtaggccctcgcgattgccatattactggccgtaatttaccg
attgagatccgctctgcggtatcgatgtttggccacatgggtattgagatggacccccgt
gagcttactgagcacgagcaagacaccctgaaatcggctatttcgctatataaaaaatac
cgccatattacccacggcggcgatttataccgtatggatgatgatggccttaacgtgaag
tttggttatgtatcaaaagacaaagccgagggtatttttgcctacaatagcgtgaaagaa
accgggcgtactacaccatctcgtttctattttgccgggcttgatgccgataagtcctat
acccttgagcgggtttggccgggtacattgaaagaatactcaccgtctattttgcaaaaa
acagacgggcaagtatttagcggtgaagcgttaatgaaatacggtatgcaaatgccggtt
ttattcccgcaaacttcgcttatttataccgctaaagaagtgtag

DBGET integrated database retrieval system