KEGG   Alteromonas sp. SN2: ambt_18340Help
Entry
ambt_18340        CDS       T01513                                 

Definition
uroporphyrinogen-III synthetase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
alt  Alteromonas sp. SN2
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ambt_18340
Enzymes [BR:alt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ambt_18340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4103724..4104491
Genome map
AA seq 255 aa AA seqDB search
MYVVANLYYYKLMLLITRPLPKLQASADAFEQAGIDTIGVATSDIQSIPSKAGKLQQFLL
GSPSINIIIVTSIYAVPAALHALNQASFLSAPPTLIAVGDATANALHSANLPLKIVTPSL
HTSEGILVMQQLNEANCTQVVIIKGEGGRDKLSHVLGERGISVTEFCVYKREPLTNPIYT
KRWKIGDVSGIIATSENLAKQLISTHSRQILALPWLTVSERVATSLRNLGIARVSVCNRA
TDQALIAWVKENWEY
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtatgttgttgctaacttatattattacaaacttatgctgctgattacccgccccctt
cctaaattacaagcaagtgcagatgcatttgagcaggcgggtattgatacaataggcgtt
gctacatcagatattcaaagcatccctagtaaggcaggcaagctacaacagtttttgttg
ggctcgcccagcattaatattattattgttactagcatttatgccgtgccagcagcactt
cacgcacttaatcaagcctcttttttatctgcgccccctacgttaatagcggttggcgat
gccacggctaacgcattacacagcgctaatttacctttaaaaatcgtcaccccttcgcta
catacgtccgaaggtatactggtcatgcagcaacttaatgaggcaaactgtacacaagtc
gttattataaagggcgaaggtggtagagataagctttctcacgttttgggcgagagaggc
atatcggttaccgagttttgtgtttataaaagagaaccacttacaaacccaatttacaca
aagcgctggaaaattggcgatgttagcggcattatcgctacaagcgagaatttagcaaag
caacttatttctactcatagtagacaaatattagcgttgccctggttaacggtaagtgaa
cgagttgcaacgagtttacgtaatcttgggatagcacgcgtttcggtgtgcaaccgcgcc
accgatcaggcattaattgcctgggtaaaggaaaattgggagtattaa

DBGET integrated database retrieval system