KEGG   Alteromonas sp. SN2: ambt_18410Help
Entry
ambt_18410        CDS       T01513                                 

Definition
putative F420-dependent oxidoreductase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
alt  Alteromonas sp. SN2
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    ambt_18410
Enzymes [BR:alt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     ambt_18410
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     ambt_18410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4120668..4121450
Genome map
AA seq 260 aa AA seqDB search
MRALTINTIEGLPDIREGDNLVGLIIEKLTAQRQVLCEGDVLVIAQKIISKAEGAVCHVD
DITPTQEAIDVAEKVNKDPRKVTVILSESTRLVKVHKHPGANEGIILTEHRLGHISANAA
VDESNTDNPGELILLPKDPDASAREIAESLCKYYGAPAHSIGVVISDTFGRPWRLGQTNV
AIGVANVPALNPLFGECDAWGRPLKVTAPALADELAAASGLLMSKQGKCPVILFKGLEWE
SNPDSKASDLLRPTQEDLFA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcacttaccatcaacacaattgaaggcctaccggatatccgcgaaggcgacaat
cttgtgggcttgataattgagaagcttaccgcacagcgacaggttttatgtgaaggcgat
gtattggttattgcccagaaaatcatatcgaaggctgaaggcgcggtttgccatgttgac
gatattaccccaacgcaagaggccatagacgtggctgaaaaggtgaataaagaccctcgc
aaagttacggttattttatcggaatctacccgcttggtaaaagtgcataaacaccctggc
gctaacgaaggcattattcttaccgaacatcgtttaggtcatattagtgctaacgcagcg
gttgatgagtcgaacaccgataacccaggcgagttaattttactccccaaagatcccgac
gctagtgcgcgagaaattgctgaaagtctatgcaaatattatggcgcaccagcccacagt
attggcgtggtgataagtgatacctttggccgcccttggcgattaggccaaaccaatgtg
gccattggcgtagcgaatgtgcccgccttaaacccactttttggtgaatgtgatgcttgg
ggtcgccccctaaaagttacagcgcctgcccttgccgatgaacttgctgcagcttctggc
ttgctgatgagtaaacaaggtaagtgtcccgttattttattcaaagggcttgaatgggaa
agtaacccagacagtaaagcctcagacctgttaagaccaacccaagaggatttatttgca
tga

DBGET integrated database retrieval system