KEGG   Alteromonas sp. SN2: ambt_19150Help
Entry
ambt_19150        CDS       T01513                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
alt  Alteromonas sp. SN2
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:alt00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:alt00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:alt02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4308255..4309940
Genome map
AA seq 561 aa AA seqDB search
MDRRSFIKLSSITGASVAIATGLAGCVSTKKPQDSASFTHGIASGDPLHNSVILWTRALP
DKKAANANILWEVSTSKDFSTLVASDIAQAQQSRDYTVKVDVSGLNPATRYYYRFKSANS
MSEVGTTLTLPKENVSQVTFGVFSCSNYPAGFFTPYADAASQQNIDFVLHLGDYIYEYDG
EGYATEHAKELGRTFAEDNDTELYTLEDYRKRYALYRTDQGLLDLHRAKPFIVVWDDHEI
TNDTYKDGAENHQEDEGDFYARRAAAVQAYYEWLPIRPTFGESRLEIYRQFTFGDLVDLY
MLDTRVLARDKQLAYSDFRNPDAPDSEAFDLPSFTKAISAPERGLLGDAQRTWLNTAMND
SKAKWQVLGQQLLIGRMMFPASIFNGVPFEKIPAHVHALANSKRRKLAGETISAQEEKLL
AAAMPYNLDAWDGYPVEREKLLTAVQQLNKPVIALAGDTHNAWHNTLTLQDGTAVATELA
TSSVSSPGMEHYLKMDADTAKIMAEDLPVLIDDLAYCNLHQRGYLTVSFTEKQAVATWRY
VDTIKSTSSSTVNSHEFVIEG
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggacagacgttcttttattaaattaagttctattaccggtgccagtgttgccattgca
acaggtttagccggctgtgtttctactaaaaagccacaagatagtgccagcttcactcat
ggcattgctagcggcgatcctctgcataatagcgttattctttggacccgagctttgccc
gacaaaaaagcagcaaacgctaacattttatgggaagtatctacttcaaaagattttagt
acgcttgttgccagtgatattgcccaggctcagcaatcacgagactatactgttaaagtt
gatgtttccggtttgaatcctgccacccgctattattatcgcttcaaaagcgcaaatagt
atgagcgaagtaggtacaacattaaccttaccgaaagaaaatgtaagccaggtaacgttc
ggagtgttttcatgttctaactaccctgcgggcttttttacgccttatgctgatgctgcg
tcacagcagaatattgattttgtattgcatttaggcgactacatttacgaatatgatggc
gaaggctatgccaccgaacatgctaaagaattaggccgcacgtttgccgaagacaacgat
accgagttgtatactcttgaagattaccgtaaacgctacgcgctctatcgtactgaccaa
ggtttattagatttacaccgtgctaagccttttattgtggtgtgggacgatcatgagatc
actaacgacacctacaaagatggtgctgaaaatcatcaggaagatgagggggatttttat
gcgcgcagagccgcggcggtgcaagcctattatgagtggctccccattcgacctaccttt
ggtgaaagcagattagaaatatatcgacagtttacctttggcgacttggttgacctatac
atgctagatactcgtgttttagcgcgagataagcagttagcctatagtgactttcgcaac
cctgatgctcccgattccgaggcttttgatttacccagctttaccaaggcgattagtgcg
ccggaacgaggtttactgggggatgctcaacgaacatggcttaacacggccatgaacgat
agcaaagcgaagtggcaagtattagggcagcagcttttaattggccgcatgatgtttcct
gcctctatctttaatggtgtcccttttgaaaaaattcctgctcatgtgcacgcccttgca
aatagcaaacgcagaaagctagccggagaaaccatttcagcacaagaagaaaagctgcta
gccgctgccatgccatacaaccttgatgcctgggatggctatccggtagaaagggaaaaa
ttgctaaccgcagtgcaacaattaaataaaccagtgatcgcgttagcgggcgacacgcac
aatgcgtggcataacaccttaaccttgcaagatggcaccgcggtggcaacggagcttgcc
acatccagtgtttcatcgccgggtatggagcattatttaaaaatggatgctgacactgcg
aaaattatggcggaggatcttcctgtacttatcgatgatttagcatattgcaatttgcat
cagcggggatatttaacggtatcttttactgaaaaacaggcggttgccacgtggcgttat
gtagatacgattaaatccacatcatccagtacagtaaatagtcatgagtttgttattgag
ggctga

DBGET integrated database retrieval system