KEGG   Alteromonas naphthalenivorans: ambt_19150Help
Entry
ambt_19150        CDS       T01513                                 

Definition
(GenBank) phosphodiesterase/alkaline phosphatase D
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
alt  Alteromonas naphthalenivorans
Pathway
alt00790  Folate biosynthesis
alt01100  Metabolic pathways
alt02020  Two-component system
Module
alt_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ambt_19150
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ambt_19150
Enzymes [BR:alt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ambt_19150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N Metallophos TAT_signal
Motif
Other DBs
NCBI-ProteinID: AEF05323
UniProt: F5ZFN2
Position
4308255..4309940
Genome map
AA seq 561 aa AA seqDB search
MDRRSFIKLSSITGASVAIATGLAGCVSTKKPQDSASFTHGIASGDPLHNSVILWTRALP
DKKAANANILWEVSTSKDFSTLVASDIAQAQQSRDYTVKVDVSGLNPATRYYYRFKSANS
MSEVGTTLTLPKENVSQVTFGVFSCSNYPAGFFTPYADAASQQNIDFVLHLGDYIYEYDG
EGYATEHAKELGRTFAEDNDTELYTLEDYRKRYALYRTDQGLLDLHRAKPFIVVWDDHEI
TNDTYKDGAENHQEDEGDFYARRAAAVQAYYEWLPIRPTFGESRLEIYRQFTFGDLVDLY
MLDTRVLARDKQLAYSDFRNPDAPDSEAFDLPSFTKAISAPERGLLGDAQRTWLNTAMND
SKAKWQVLGQQLLIGRMMFPASIFNGVPFEKIPAHVHALANSKRRKLAGETISAQEEKLL
AAAMPYNLDAWDGYPVEREKLLTAVQQLNKPVIALAGDTHNAWHNTLTLQDGTAVATELA
TSSVSSPGMEHYLKMDADTAKIMAEDLPVLIDDLAYCNLHQRGYLTVSFTEKQAVATWRY
VDTIKSTSSSTVNSHEFVIEG
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggacagacgttcttttattaaattaagttctattaccggtgccagtgttgccattgca
acaggtttagccggctgtgtttctactaaaaagccacaagatagtgccagcttcactcat
ggcattgctagcggcgatcctctgcataatagcgttattctttggacccgagctttgccc
gacaaaaaagcagcaaacgctaacattttatgggaagtatctacttcaaaagattttagt
acgcttgttgccagtgatattgcccaggctcagcaatcacgagactatactgttaaagtt
gatgtttccggtttgaatcctgccacccgctattattatcgcttcaaaagcgcaaatagt
atgagcgaagtaggtacaacattaaccttaccgaaagaaaatgtaagccaggtaacgttc
ggagtgttttcatgttctaactaccctgcgggcttttttacgccttatgctgatgctgcg
tcacagcagaatattgattttgtattgcatttaggcgactacatttacgaatatgatggc
gaaggctatgccaccgaacatgctaaagaattaggccgcacgtttgccgaagacaacgat
accgagttgtatactcttgaagattaccgtaaacgctacgcgctctatcgtactgaccaa
ggtttattagatttacaccgtgctaagccttttattgtggtgtgggacgatcatgagatc
actaacgacacctacaaagatggtgctgaaaatcatcaggaagatgagggggatttttat
gcgcgcagagccgcggcggtgcaagcctattatgagtggctccccattcgacctaccttt
ggtgaaagcagattagaaatatatcgacagtttacctttggcgacttggttgacctatac
atgctagatactcgtgttttagcgcgagataagcagttagcctatagtgactttcgcaac
cctgatgctcccgattccgaggcttttgatttacccagctttaccaaggcgattagtgcg
ccggaacgaggtttactgggggatgctcaacgaacatggcttaacacggccatgaacgat
agcaaagcgaagtggcaagtattagggcagcagcttttaattggccgcatgatgtttcct
gcctctatctttaatggtgtcccttttgaaaaaattcctgctcatgtgcacgcccttgca
aatagcaaacgcagaaagctagccggagaaaccatttcagcacaagaagaaaagctgcta
gccgctgccatgccatacaaccttgatgcctgggatggctatccggtagaaagggaaaaa
ttgctaaccgcagtgcaacaattaaataaaccagtgatcgcgttagcgggcgacacgcac
aatgcgtggcataacaccttaaccttgcaagatggcaccgcggtggcaacggagcttgcc
acatccagtgtttcatcgccgggtatggagcattatttaaaaatggatgctgacactgcg
aaaattatggcggaggatcttcctgtacttatcgatgatttagcatattgcaatttgcat
cagcggggatatttaacggtatcttttactgaaaaacaggcggttgccacgtggcgttat
gtagatacgattaaatccacatcatccagtacagtaaatagtcatgagtttgttattgag
ggctga

DBGET integrated database retrieval system