KEGG   Alteromonas sp. SN2: ambt_19500Help
Entry
ambt_19500        CDS       T01513                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
alt  Alteromonas sp. SN2
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:alt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4385023..4385520
Genome map
AA seq 165 aa AA seqDB search
MHKEHVYIGIGSNLGDPVQHVEDAFIALGLLEGTRVLTCSSLYSSKPMGPQDQPDYINAV
SLIETTLAPDKLLSALQRTEHDFGRERKGQRWGARTLDLDILLYGSQTISTPDLTVPHIG
MSEREFVLVPLFEIAQTMVMPDGKPISHWVAKCSLDGLKRLRASI
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcataaagagcacgtttatattggtattggcagcaacctaggcgaccctgttcaacat
gttgaagacgcctttattgcgctgggtctacttgaaggtactcgcgtgcttacgtgctca
tcactgtattctagtaagcctatgggtccgcaagaccaaccggattacattaacgcggta
tcgctaattgaaactacgctagcgccagataaattgctaagtgcattacagcgtaccgaa
cacgattttggtcgagaacgtaaagggcagcgatggggcgcaagaacgctcgatttggac
attttactttacggtagccaaacaatttctacgcctgatcttaccgtgccacatattggc
atgtctgaacgtgagtttgtgctagttcctctctttgaaatagctcaaactatggtcatg
cctgacggaaaacccatctctcactgggttgctaaatgctcacttgatggccttaaacgc
ctgcgcgcttccatttag

DBGET integrated database retrieval system