KEGG   Alteromonas sp. SN2: ambt_19735Help
Entry
ambt_19735        CDS       T01513                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
alt  Alteromonas sp. SN2
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ambt_19735
Enzymes [BR:alt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ambt_19735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4441086..4441769)
Genome map
AA seq 227 aa AA seqDB search
MLAKEAVIVRDALEPSISESAQRVRAALEEKGLETPMVANGLSDEQKRQKIEIAMRDVMN
TLGLDLNDDSLHDTPTRIAKMYVNEVFGGLDYRNFPKITQIENKMLLDQPVQVSDISLTS
TCEHHFVTIDGLATVSYIPNDTIIGLSKLNRLVSFFAQRPQVQERLTQQVLVAIQTLAST
EDVAVSINATHYCVKARGIRDTNSYTKTSALGGKFLSDVELRRAFFS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgttagcaaaagaagcggtcattgtgcgtgatgcactagagccatcaatttctgaatcg
gcacaacgtgttagagcagcgcttgaagaaaaagggctggaaacacctatggtggcgaac
ggtttgtccgacgagcaaaaacgtcagaagattgaaattgcaatgcgtgatgtgatgaat
acgcttgggctcgatcttaacgatgatagtttgcacgacacgccaacccgtattgcgaaa
atgtacgtgaacgaagtgtttggcggtttggattatcgtaattttcctaaaataacccaa
atcgaaaataagatgcttcttgatcagcctgttcaagtgtctgatattagtttaacgagt
acgtgcgaacaccactttgtgactattgatggcctcgctaccgtatcttatattcctaac
gatactattatcggtttgtcgaaattaaaccgcttagtgagtttctttgcacagcgccct
caagtgcaagagcggctaacacagcaagtgctagtggccattcagacattagcctctacc
gaagatgtagcggtaagcattaatgctacgcattattgtgtaaaagccagaggtatacgc
gatactaattcgtacacgaagacatccgcgctaggtggaaaattcttgtccgatgtggaa
ttgcgaagagcattttttagttaa

DBGET integrated database retrieval system