KEGG   Allochromatium vinosum: Alvin_0155Help
Entry
Alvin_0155        CDS       T01168                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
alv  Allochromatium vinosum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:alv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Alvin_0155
Enzymes [BR:alv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Alvin_0155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
163156..163791
Genome map
AA seq 211 aa AA seqDB search
MIGRLQGRILAKHPPQLLLDVNGVGYELEAPMSTFYGLPAVGETATLLTHLAVREDAWTL
YGFIRERDRALFRALIKVTGVGARMALAILSGMDAARFAQCVEQEDATALTRLPGIGKKT
AERLIIEMRDRLGGVMIAPGAALPSAAGQPASGTTTADVVAEDQALADAVSALVALGYKP
PDANRMARAVDDGAKTAEEIIRAALRSVNPV
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacgacttcaaggccggattctggccaagcatccgccgcagctcctgctcgac
gtcaacggtgttggctatgagctggaagcccccatgtccaccttctacggcctgccggcg
gtgggcgagacggccacgctcctgacccatctggcggtgcgcgaggatgcctggaccctc
tatggcttcatccgtgagcgcgaccgcgcgctctttcgggcgctgatcaaggtgacgggc
gtcggggcgcgcatggcgctcgccatcctctcgggcatggacgcggcacgcttcgcccag
tgcgtcgagcaggaggacgccacggccctgacgcgcctgccgggcatcggcaagaagacc
gctgagcgtctcatcatcgagatgcgcgaccggctcggtggggtgatgatcgcgcccggt
gcggcgttgccgtctgcggccggacagccggcgagcggtacgaccaccgctgatgtggtt
gccgaggatcaggcgctcgccgatgccgtcagcgccctggttgcgctcggctacaagccg
ccggacgccaaccgcatggcgcgcgccgtcgacgatggggccaagaccgccgaggagatc
atccgcgccgctctgcgctccgtgaatccggtctga

DBGET integrated database retrieval system