KEGG   Allochromatium vinosum: Alvin_0165Help
Entry
Alvin_0165        CDS       T01168                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
alv  Allochromatium vinosum
Pathway
alv00010  Glycolysis / Gluconeogenesis
alv00620  Pyruvate metabolism
alv00640  Propanoate metabolism
alv00680  Methane metabolism
alv01100  Metabolic pathways
alv01110  Biosynthesis of secondary metabolites
alv01120  Microbial metabolism in diverse environments
alv01130  Biosynthesis of antibiotics
alv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alvin_0165
   00620 Pyruvate metabolism
    Alvin_0165
   00640 Propanoate metabolism
    Alvin_0165
  Energy metabolism
   00680 Methane metabolism
    Alvin_0165
Enzymes [BR:alv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Alvin_0165
Lipid biosynthesis proteins [BR:alv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Alvin_0165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADC61134
JGI: Alvin_0165
UniProt: D3RVK7
Position
complement(173927..175873)
Genome map
AA seq 648 aa AA seqDB search
MSEEKVYPVPAAIAAKAHINAEQYAAMYQRSIDDPAGFWAEQAEQFVTWSRKWDSVMDYS
YQADDLHINWFQGGKLNVSYNCLDRHLATRGDQVAIIWEGDDPNVDRKITYRELHEEVCR
LANVLKSRGVQKGDRVCIYLPMIPEAAVAMLACTRIGAVHSIVFGGFSPDSLRDRVLDSE
CKLVITSDESVRGGRHVPLKKNADIAMRECPNVDTVLVVRRTGGNVDWVEGRDVWYHEAV
AAAATECAPEEMDAEDPLFILYTSGSTGKPKGALHTTGGYLVYAAMTHKYTFDYQDGEIY
WCTADVGWVTGHTYIVYGPLANGATSVMFEGIPNYPDMSRFWDVVDKHNVSIFYTAPTAI
RSLMRAGEEPVKKTSRQSLRILGSVGEPINPEAWEWYHNVVGDGRCPIVDTWWQTETGGH
LITPLPGATALKPGSATRPFFGVVPALVDPSTGVRIEGAAEGALVICQPWPGQMRTVYGD
HQRYVDTYFKQYPGYYFTGDGARRDADGYYWITGRIDDVLNVSGHRLGTAEIESALVLHP
HVAEAAVVGYPHDLKGQGIYAYVTPMAGVEPTDELKKELVSLVRGEIGPIAIVDIIQWAP
GLPKTRSGKIMRRILRKIAANEIDSLGDTSTLADPTVVEDLIENRAVK
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaagaaaaggtctatccggttcctgcggcgatcgccgccaaggcccacatcaac
gccgagcagtatgccgcgatgtatcagcgctcgatcgacgatccggccggcttctgggcc
gagcaggccgagcagttcgtgacctggagccggaagtgggactcggtcatggactacagc
tatcaggccgacgatctgcacatcaactggttccagggcggcaagctcaacgtctcctac
aactgtctggaccgtcatctggccacccgtggcgatcaggtcgccatcatctgggaaggc
gacgatccgaacgtggaccgcaagatcacctatcgcgagctgcacgaggaagtctgccgt
ctggccaacgtcctcaagtcgcgcggcgtccagaagggcgaccgggtctgcatctatctg
ccgatgatccccgaggcggcggtggccatgctggcctgtacccgcatcggcgcggtgcac
tcgatcgtcttcggcggcttctcgcccgactcgctgcgcgaccgcgtgctcgactccgag
tgcaaactggtcatcacctcggatgagagcgtgcgcggcgggcgtcacgtcccgctcaag
aagaacgccgacatcgccatgcgcgagtgcccgaacgtcgacaccgtgctcgtggtgcgc
cgcaccggcggcaacgtcgactgggtcgagggccgcgatgtctggtatcacgaggctgtc
gccgcggccgccaccgagtgcgcgcccgaggagatggacgccgaagatcccttgttcatc
ctctacacctccggctccaccggcaagcccaagggcgccctgcacaccaccggcggctat
ctggtctatgccgccatgacccacaagtacaccttcgactaccaggacggcgagatctac
tggtgcaccgccgacgtcggctgggtcacgggtcacacctacatcgtctatggcccgctg
gccaacggcgccacctcggtcatgttcgagggcatcccgaactatccggacatgtcgcgc
ttctgggacgtggtcgacaagcacaatgtctccatcttctacaccgccccgaccgcgatc
cgctcgctgatgcgcgccggcgaggagccggtcaagaagacttcgcgccagtcgctgcgc
atcctcggctcggtcggcgagccgatcaaccccgaggcctgggagtggtaccacaacgtc
gtcggtgacggacgctgcccgatcgtcgacacttggtggcagaccgagaccggcggccat
ctgatcactccgctgccgggcgccacggcactcaagccgggttcggccacccgccccttc
ttcggcgtggtgccggcgctggtcgatccgtcgacgggcgtgcgcatcgagggcgcggct
gaaggcgcacttgtcatctgccagccctggcccggtcagatgcgcaccgtctatggcgat
catcagcgctacgtcgacacctacttcaagcagtatccgggctactacttcaccggtgac
ggcgcgcgccgtgatgccgacggttactactggatcaccggccgcatcgacgacgtgctc
aacgtctcgggccaccgtctcggcaccgccgagatcgagtcggcgctggtgctgcatccg
cacgtcgccgaggcggcggtggtcggctatccgcacgacctcaagggtcagggcatctat
gcctatgtcaccccgatggccggtgtcgagccgaccgacgagctgaagaaggaactggta
tcactggtgcgcggcgagatcggcccgatcgccatcgtcgacatcatccagtgggcgccg
ggtctgcccaagacccgctcgggcaagatcatgcgccgcatcctgcgcaagatcgccgcc
aacgagatcgattcgctcggtgacacctccaccctggccgatccgaccgtggtcgaggat
ctgatcgagaaccgcgccgtcaagtaa

DBGET integrated database retrieval system