KEGG   Allochromatium vinosum: Alvin_0369Help
Entry
Alvin_0369        CDS       T01168                                 

Definition
disulfide bond isomerase, dsbC/G-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
alv  Allochromatium vinosum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
434288..435022
Genome map
AA seq 244 aa AA seqDB search
MNRLTQRLLIAAALVLSSGLALAAPEQKIREALKEIAPDLEISNIQPSPIKGLYEVMAGT
DLMYITADGRHFISGHIVDLKTREDLTEPRLSEARKRLIDRIGENDMVVFGDKDAKHTIT
VFTDIECGYCRKLHSQIADYEKEGIRVRYLFFPRAGKGSPAFDEAVSVWCAGDAEARRTA
MTKAKAGEPVASKTCDNPVEEHMALGADLGLRGTPAILTDTGELIPGYVEPKRLAAQLNS
QSGG
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaacagactgactcaacgcctcctgatcgccgccgccctggtcctgtccagcggcctg
gcgctcgccgcgcccgagcagaagatccgtgaggcactcaaggagatcgctcccgatctc
gagatcagcaacatccagccctcgccgatcaagggactctacgaggtcatggccggcacc
gatctgatgtatatcaccgccgatggccgtcacttcatcagcggtcacatcgtcgatctc
aagacgcgcgaggatctcaccgagccgcgtctgtccgaggcgcgcaagcggctgatcgac
cgtatcggcgagaacgacatggtcgtcttcggcgacaaggatgccaagcacaccatcacc
gtcttcaccgacatcgagtgcggctactgccgcaagctgcacagccagatcgccgactac
gagaaggaaggcatccgggtgcgttacctgttcttcccgcgtgccggcaagggcagtccg
gccttcgacgaggccgtctcggtctggtgcgccggtgacgctgaggcccgtcgcacggcc
atgaccaaggcgaaggccggtgagccggtcgcctccaagacctgtgacaatccggtcgag
gagcacatggcactcggtgccgatctcggattgcgtggtacgccggccatcctcaccgac
accggcgaactcatccccggctatgtcgagcccaagcgtctggctgctcagctcaacagc
cagtccggtggctga

DBGET integrated database retrieval system