KEGG   Allochromatium vinosum: Alvin_0412Help
Entry
Alvin_0412        CDS       T01168                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
alv  Allochromatium vinosum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:alv01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:alv00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
475236..476372
Genome map
AA seq 378 aa AA seqDB search
MSPTLELACELVRRPSVTPEDQGCQELIAERLAAIGFTVEPMPFGEVTNLWARRGSEGPL
LCLAGHTDVVPAGPLDLWDSDPFDPVIRDGMLHGRGAADMKGSVAAMVTAVESFVAAHPD
HPGSLAFLLTSDEEGPAVNGTAKVIERLQQRGEHIDYALVGEPSSREQLGDSIKNGRRGS
LSGFLTIHGKQGHVAYPHLAKNPFHAAADALAALCAVVWDQGNAYFPPTSFQIANLNMGT
GAENVIPGQLEAQFNLRFSTELDPETIKRRVRAILDQGDFDYELSWRLSGHPFLTTPGEL
VDAARSAIREVCGIETELSTSGGTSDGRFIAPTGAQVLELGPLNATIHQVDECVAVADLD
QLHRIYGRMIERLLLPAA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccacgctcgaactggcctgtgaactcgtccgccgtccctcggtcacgcccgag
gatcagggctgtcaggaactcatcgccgagcgtctggcggcgatcggcttcaccgtcgag
ccgatgcccttcggcgaggtcacgaatctctgggcgcggcgcggaagtgaaggcccgctg
ctctgtctggccggacataccgacgtggtgccggccgggccgctggatctctgggactcg
gaccccttcgacccggtcattcgcgacgggatgctccatggtcggggcgcggcggatatg
aagggttcggttgcggccatggtgacggcggtcgagtccttcgtcgccgcgcacccggac
catccgggttcgctcgcctttctgctcaccagtgatgaggagggaccggcggtcaatggc
acggccaaggtcatcgagcggctccagcagcgcggcgagcacatcgactatgccctggtc
ggcgagccgtcgagtcgcgagcaactgggggattcgatcaagaacggacggcgcggcagt
ctctcgggcttcctgaccatccacggcaaacagggccatgtggcctatccgcatctggcc
aaaaatcccttccatgcggcggcggatgcactggcggcactctgcgccgtggtctgggat
cagggcaacgcctacttcccgccgaccagcttccagatcgccaatctcaacatgggcacg
ggcgccgagaacgtcatccccggccagctggaggcgcagttcaacctgcgtttttcgacc
gaactcgaccccgaaaccatcaagcgccgcgtgcgcgccatcctggaccagggcgatttc
gactacgaactctcctggcgcctgtcgggccatcccttcctgacgacgcccggcgagctg
gtcgacgctgcgcgttcggccatccgcgaagtctgcggcatcgagaccgaactctcgacc
agcggcggcacctcggacggacgcttcatcgctccgaccggagcccaggtgctcgaactc
gggccgctcaacgcgaccatccatcaggtcgatgaatgtgtcgcggtcgcggatctcgat
cagctgcaccggatctacggtcgaatgatcgaacggctccttctgccggccgcttga

DBGET integrated database retrieval system