KEGG   Allochromatium vinosum: Alvin_0427Help
Entry
Alvin_0427        CDS       T01168                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
alv  Allochromatium vinosum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Alvin_0427
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Alvin_0427
Enzymes [BR:alv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Alvin_0427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(494318..495781)
Genome map
AA seq 487 aa AA seqDB search
MLTDALTHLLATTDFAWSRPAPEAPRPTNIQWRADACDDGSILLFQRFDDGLTDSEIHRR
YFAGRRFAALVTNRPLDCFDRMPGVALHVTRPGDWAEVVRRFCDVVYPLAPGALRFIGVT
GTNGKTTTVKYLESILAAHGRRVLSIGTLGVFLDGVRQVETGFTSPPLIELRRLLHAHQD
QADVVVMEASSHALDQGRVAGIPFQDAGWTNFTQDHLDYHRDEASYFAAKAHLLDLIRPG
GRLYCTSRAVADRLAALGPTPVPVEVLEPARLPPEAIAAKPFLALAHNRANYALAVALAE
RVLDAMPTDETRQHWRHLQPVDGRFDCRVHGNRAIVIDFAHTPDALDTILGAIREGFPDA
RVVTLFGCGGDRDRSKRPLMGAAVARHSDAIIVTSDNPRHEPPERIIDDILTGFPEDQDY
SVVVDRAEAIARLFDQLAARPDDEPWVALIAGKGHERYIDRDGHKTPYSDQEQVDANLQR
LGWTSAS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccgacgccctcacccatctgctcgccaccaccgacttcgcctggagccgcccc
gcgcccgaggcgccgcgcccgaccaacatccagtggcgcgccgatgcctgtgacgacggt
tccatcctcctcttccagcgcttcgatgatggcctgacggacagcgagatccatcggcgc
tatttcgccggacgacgtttcgccgcactcgtcaccaaccgtccgctcgactgcttcgac
cggatgccaggagtcgcgctccatgtcacccgtccgggcgactgggccgaggtcgtgcgc
cggttctgtgatgtcgtctatccgctcgcgcccggtgcgctgcgcttcatcggtgtcacg
ggcaccaacggcaagacgacgaccgtgaagtatctggaatccatcctcgccgcgcatggc
cggcgcgtgctgtcgatcggcacgctcggcgtcttcctcgatggcgtgcgtcaggtcgag
accggcttcacctcgccgccgctgatcgaactgcgccggctcctgcacgcccatcaggat
caggccgacgtggtggtgatggaggccagcagtcatgcactcgatcagggtcgggtcgcg
ggtatcccgttccaggacgccggctggaccaatttcacccaggatcatctcgactatcac
cgcgacgaggccagctattttgcggccaaggcgcatctgctcgatctgatccggcccggc
ggacggctctactgcaccagccgcgccgtcgccgatcggctcgccgcgcttggtccgacg
ccggttccggtcgaggtgctggagccggcccggctcccgcccgaggcgatcgcggccaag
cccttcctcgccctcgcgcacaatcgcgccaattatgcgctggcggtcgctctggccgag
cgtgtgctcgatgccatgccgaccgacgagacacgccaacactggcgccatctccagccg
gttgacggacgcttcgactgccgcgtccacggcaaccgcgccatcgtcatcgacttcgcc
cacaccccggacgcgctcgacaccatcctcggcgccattcgcgagggcttccccgacgcg
cgcgtggtcacgctcttcggctgcggcggcgatcgcgaccgctccaagcgtccgctgatg
ggcgccgccgtcgcccgccactcggacgcgatcatcgtcacctccgacaatccgcgccac
gagccgcccgagcgcatcatcgacgacatcctgaccggattccccgaagatcaggactac
agcgtcgtcgtcgaccgcgccgaggccatcgcccggctcttcgaccagctcgccgcccgg
ccggacgatgaaccctgggtcgcactcatcgccggcaagggccacgagcgctatatcgat
cgcgacggacacaagacgccctacagcgatcaggaacaggtcgacgccaatctgcaacga
ctcggctggacatcggcttcctga

DBGET integrated database retrieval system