KEGG   Allochromatium vinosum: Alvin_0490Help
Entry
Alvin_0490        CDS       T01168                                 

Definition
glycoside hydrolase family 3 domain-containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
alv  Allochromatium vinosum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Alvin_0490
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Alvin_0490
Enzymes [BR:alv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Alvin_0490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(565901..566983)
Genome map
AA seq 360 aa AA seqDB search
MPLGPIMLDLAGTALDAEDRELLRHPAVGGVILFARNYESPEQLAALTAAIHAVREPALL
IGVDQEGGRVQRFRDGFTRLPPAGRLGRLHRERPAQARAVCESIAWLMAAELRAVGVDFS
FAPVLDLDRGISRVIGDRGFSPDAQAVGELASSWMRGARQAGMASVGKHFPGHGGVEADS
HTELPRDERPFVDLELEDLAPFRRLIDQGLEAMMPAHVIYPCIDPRPAGFSPVWLRQILR
QQLGFQGVIFSDDLNMEAAGAGGDHVERAQAAVAAGCDMLLICNNRPAAVATLAAFRDHR
DPATSLRLLRMRGRKPLDRVRLHESPEWHRALGHIAELESHDSLELPLEDPTTPEPRTKP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgccacttggccccatcatgctcgatctcgcgggaacggcgctcgacgccgaggaccgc
gaactgctgcgccacccggccgtcggtggcgtcatcctctttgcacgcaactacgaatcg
cccgagcagctcgcggcgctgacggccgccatccatgccgtgcgcgaaccggcgctgttg
atcggcgtcgatcaggaaggcggacgggtgcagcgtttccgcgacggcttcacgcgcctg
ccgccggccgggcgtctgggccggctccatcgcgagcgcccggcccaggcgcgcgccgtc
tgcgagtccatcgcctggctgatggccgccgagttgcgcgcagtcggagtggacttcagc
tttgcgcccgtgctggatctggatcgcgggatcagccgggtgatcggcgatcgcggtttc
agtcctgatgcgcaggcggtcggtgagctggcatcgagctggatgcgcggtgcgcgtcag
gcgggcatggccagcgtcggcaagcattttccggggcatggcggggtcgaggccgattcg
cacaccgagctgccgcgcgacgagcgtcccttcgtcgatctggaactggaggatctggca
cccttccgccgtctcatcgaccagggactggaggcgatgatgccggcgcatgtgatctat
ccgtgcatcgatccgcgcccggcggggttctcgccggtctggttgcgccagatcctgcgc
cagcagctcggattccagggcgtcatcttcagcgatgacctcaatatggaggcggccggt
gcgggcggcgatcatgtcgagcgcgcgcaggcggcggtggcggccggttgcgatatgctc
ctgatctgcaacaatcgcccggcggctgtggccaccctggcggccttcagggaccatcgc
gacccggcgaccagtctgcgactgctgcggatgcgcgggcgcaagccgctcgatcgcgtc
cgcctgcacgaaagccccgaatggcaccgcgccctgggccatatcgccgaactcgaatcc
catgactcgctcgagctgccgctcgaggatcccacgactccggagccaagaacgaaacca
tga

DBGET integrated database retrieval system