KEGG   Allochromatium vinosum: Alvin_0627Help
Entry
Alvin_0627        CDS       T01168                                 

Definition
2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
Orthology
K02551  
2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [EC:2.2.1.9]
Organism
alv  Allochromatium vinosum
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Ubiquinone and other terpenoid-quinone biosynthesis [PATH:alv00130]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(733957..735717)
Genome map
AA seq 586 aa AA seqDB search
MTDQGCLNLRWALALFDGLVEGGMRHLVLSPGSRSTPLVLAAQRQPALTVTPILDERSAA
FFALGVARASGRPVGLVCTSGSALAHWFPAVIEASESGIPLVLLSADRPPELRGWGANQT
IDQTRFFGVHVRAFHDPGTPEDSPGAVKLMRALGRRAAVESQGDWPGPVHLNLPFREPLV
PGPDCRIEAAPIQTESAVSDTMGTRRPARPAGWGLPQTPPRSDWMSARISHGSGRGVICC
GPGDWTADGAEALWHLAMRLEVPVLCDPLSGLRFGCASEHRLTRYDSLLRHPATAAALKP
DWVLRFGRAPVSKTLLGWLADVPTILVDAGRGWSDPNHDVRLKIDADPAAFCVWLADADP
EPGTPDPDWFARWLQAERRLERFAAEYLDQAPWCEGHLIRDLIAQVPEGEGLLCANSMPI
RQLDTWSGSRVRPLRVFGHRGASGIDGQTSTLAGLNAGGLPTTGLLGDLSFLHDLSGLPA
LRTLSRPCIVINNGGGRIFDYLPQHGLPGFETLWRTPVAVDLRALAGTFGLAHRSVSDRD
GFRQALTESMQTDRPSGLIEVVIDADLSRQIHRDFWRAVSVRRDDA
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcagggctgtctgaatctgcgctgggcgctggccctgttcgatggactggtc
gagggtggaatgcgtcatctggtgctttcgcccggatcgcgctccacgccgctggtgctg
gcggctcagcgtcaaccggcactgaccgtcacgccgatcctcgacgagcgcagtgcggcc
tttttcgcgctgggcgtggcgcgggcctcggggcgtccggtggggctggtctgcacctcg
gggagcgcgctcgcccactggtttccggcggtcatcgaagcctcggagtccgggattccg
ctggtgctgctctcggccgatcgtccgcccgaactgcgcggctggggggcgaaccagacc
atcgaccagacccgtttcttcggcgtgcatgtgcgcgctttccatgatccgggtacgccc
gaggattcgcccggcgcagtcaaactgatgcgggcactgggtcggcgcgcggcggtcgag
agccagggcgactggccggggcctgtgcatctgaatctgccttttcgtgaaccgctggtt
ccggggccggattgccggatcgaggccgcaccgattcagacggagtcggccgtgtccgac
accatgggcacgcgacgcccggcccgtccggcgggctggggtctgcctcagactccgccc
cggtcagactggatgtcggcgcggatttcgcacggctctgggcgcggtgtgatctgctgc
gggccgggcgactggacggcggatggcgcggaggcgctctggcatctggcgatgcggctc
gaagtacccgtgctgtgcgatccgctgtcgggtttgcggttcggttgcgcctcggaacat
cgtctcacccgttacgacagtctgctccgccatccagcgaccgctgccgcactcaagccg
gattgggtgctgcgcttcggacgcgcgccggtctccaaaacactgctgggctggctggcg
gatgtcccgacgattttggtcgacgccgggcgcggctggagcgatcccaatcatgacgtc
cgactcaagatcgacgccgatccagccgccttttgcgtctggcttgctgacgcggatccg
gaacccggcacaccggacccggattggttcgcgcgctggctccaggccgaacgccgtctg
gagcgcttcgccgccgagtatctcgatcaggcgccctggtgcgagggacacctgatccgc
gatctcatcgcccaggtgcccgagggcgaaggattgctgtgcgccaattccatgccgatc
cgccagctcgacacctggtcgggcagtcgcgttcggccactcagggtctttggccatcgc
ggcgcgagcggcatcgacggtcagacctcgacgctggccggactcaacgccggaggactc
ccgaccaccgggctgctcggtgatctgtccttcctgcacgatctcagcggactgccggca
ctgcgcacgctctcacggccctgcatcgtcatcaacaacggcggcgggcgcatcttcgac
tatctgccccagcatgggctgcccggcttcgagacgctgtggcgcacgccggtcgcggtc
gacctgcgagccctggcaggaaccttcgggctggcccatcgctcggtttccgatcgcgac
gggttccgccaggccttgaccgaatccatgcagacggaccgtccgtcaggactgatcgag
gtcgtcatcgacgccgatctgagtcgacagatccatcgcgatttctggcgggccgtcagt
gtgcggcgtgacgatgcctga

DBGET integrated database retrieval system