KEGG   Allochromatium vinosum: Alvin_0635Help
Entry
Alvin_0635        CDS       T01168                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
alv  Allochromatium vinosum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Alvin_0635
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Alvin_0635
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Alvin_0635
Enzymes [BR:alv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Alvin_0635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(743264..744625)
Genome map
AA seq 453 aa AA seqDB search
MNDTVKYLLDEQHLPRFWYNINADLPKPLDPVLHPGTQQPISPEELEVIFPRGVIEQEMS
TEREIEIPEPVREVWRQWRPSPLYRARRLEQALKTPAKIFYKYEGVSPSGSHKANSAIAQ
AFYNKVEGVKRITTETGAGQWGSSLSLAGSMFGIEILVYMVKVSYNQKPYRRAFMEAFGA
QCIASPSNTTESGRAVLAEHPDSTGSLGIAISEAVELAAQREDTKYALGSVLNHVLLHQT
VIGLEAMKQLEMADAYPDMVIGCTGGGSNFAGIAFPFLGEQLRGGRQVECIAVEPSACPT
LTKGRFAYDFGDTAHLTPLCKMFTLGSSFVPPGFHAGGLRYHGMAPQVSHLAELGLIAPR
SYNQLECFAAGLQFAKAEGIIPAPEANHAVRAAIHEAEKCRETGEAKTILFNLSGHGNFD
MQAYTDYLGGKLKDLDYAENEVAMALAGLPSIG
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaccgtcaaatatctgctcgacgagcagcacctgccccgcttctggtacaac
atcaacgccgatctgcccaagccgctcgatccggtgctgcatccgggcacccagcagccg
atctcgcccgaggagctggaagtcatcttcccgcgcggcgtcatcgagcaggagatgagc
accgagcgcgagatcgagattccggagccggtgcgcgaggtctggcgtcagtggcgtcca
tccccgctctatcgcgcgcgccgtctggagcaggcgctcaagaccccggccaagatcttc
tacaaatacgagggcgtcagcccctccggcagccacaaggccaattcggccatcgctcag
gcgttctacaacaaggtcgagggtgtcaagcgcatcaccaccgagaccggcgccggtcag
tggggttcgtcgctctcgctcgccggctccatgttcgggatcgagatcctggtctacatg
gtcaaggtcagctacaaccagaagccctatcggcgcgccttcatggaggcctttggcgcc
cagtgcatcgccagccccagtaacaccaccgagtccggtcgcgccgtgctcgccgagcat
ccggacagcaccggcagtctgggcatcgccatcagcgaggcggtggagctggccgcgcag
cgcgaagacaccaaatacgccctcggcagcgtgctcaaccatgtgctcctgcaccagacc
gtgatcggtctggaggccatgaagcaactggagatggccgacgcctatccggacatggtc
atcggctgcaccggcggcggcagcaacttcgccggcatcgccttccccttcctcggcgag
cagctgcgcggcgggcgtcaggtcgagtgcatcgcggtcgaaccatcggcctgtccgacg
ctcaccaagggacgcttcgcctacgacttcggcgacacggcgcatctcaccccgctgtgc
aagatgttcacgctgggatcgagcttcgtgccgcccggtttccacgccggcggcctgcgc
tatcacggcatggccccgcaggtcagtcatctggctgaactcggcctcatcgcgccgcgc
tcctacaaccagctcgaatgcttcgccgccggtctccagttcgccaaggccgagggcatc
atcccggcgcccgaggccaaccacgcagtgcgcgcggccatccatgaggccgagaagtgc
cgcgagaccggcgaggccaagaccatcctgttcaacctcagcggtcacggcaacttcgac
atgcaggcctataccgactatctgggcggcaagctcaaggatctggactatgccgagaac
gaggtcgccatggcgctcgccggattgccgtcgatcggctga

DBGET integrated database retrieval system