KEGG   Allochromatium vinosum: Alvin_0679Help
Entry
Alvin_0679        CDS       T01168                                 

Definition
Cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
alv  Allochromatium vinosum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
793806..794852
Genome map
AA seq 348 aa AA seqDB search
MKRSTLTTFVSLALLLSGSALADDQTLREKAARAGLAPLPETVPDPAGNPVTPEKVQLGK
KLFFEPRLSASGLISCNTCHNLGMGGDDNLPTSVGHGWQKGPRNAPTVYNAVFNRAQFWD
GRAADLKEQAKGPIQAGVEMANRPDQVVATLKSLPEYVTWFGEVFPGEDDPVNFENVVKA
IEAFEVKLVTPGAPFDRFMNGADRAMSDEQKAGLVLFVDRGCTACHNGVNVGGQNYFPFG
LIKRPGADILPPEDKGRFEVTHSASDEYVFRAAPLRNVALTAPYFHSGQVWDLKQAVSVM
GTAQLGAELGDAEASQIAAFLRSLTGVAPQILYPELPVETAATPRPQL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctcgaccttgacgaccttcgtctctctggcgctgttgctgtccggcagtgcc
ctggccgacgaccagaccctgcgcgaaaaggccgcgcgcgccggactcgctccgctgccg
gagaccgtgcccgatccggccggcaatccggtcacacccgagaaggtccagctcggcaag
aagctgttcttcgagccgcgtctgtcggccagtggactcatcagctgcaatacctgccac
aacctcggcatgggcggcgatgacaatctgccgacctcggtcggtcacggctggcagaag
ggaccacgcaacgccccgaccgtctacaacgccgtcttcaaccgggcgcagttctgggac
ggtcgcgccgcggatctgaaggagcaggccaagggaccgatccaggccggggtcgagatg
gccaacaggcccgatcaggtcgtggccacgctcaagagcctgccggagtacgtaacctgg
ttcggcgaggtcttccccggcgaggacgatccggtcaatttcgagaacgtggtcaaggcg
atcgaagccttcgaggtcaagctggtcacgccgggcgcgcccttcgaccgcttcatgaac
ggcgccgaccgcgccatgagcgacgaacagaaagccgggctggtgctcttcgtcgatcgt
ggctgcacggcctgtcacaacggcgtcaacgtcggcgggcagaattatttcccgttcgga
ctcatcaagcgccccggtgccgacatcctgccgccggaggacaagggccgcttcgaggtc
acgcactcggcctcggatgaatacgtcttccgtgccgcgccgctgcgcaacgtcgccctg
accgcgccctatttccactccgggcaggtgtgggatctcaagcaggcggtgtccgtgatg
ggcacggcgcagctcggcgccgaactcggcgatgcggaagcgagccagatcgccgccttc
ctcaggtcactcacgggtgtcgcgccccagatcctgtatccggagctgccggtcgagacg
gccgccacaccgcgtccgcaactctga

DBGET integrated database retrieval system