KEGG   Allochromatium vinosum: Alvin_1169Help
Entry
Alvin_1169        CDS       T01168                                 

Definition
(RefSeq) MCP methyltransferase/methylesterase, CheR/CheB with PAS/PAC sensor (EC:2.1.1.80 3.1.1.61)
  KO
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
alv  Allochromatium vinosum
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:alv00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Alvin_1169
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Alvin_1169
Enzymes [BR:alv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Alvin_1169
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Alvin_1169
Two-component system [BR:alv02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Alvin_1169
Bacterial motility proteins [BR:alv02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Alvin_1169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1350539..1353622
Genome map
AA seq 1027 aa AA seqDB search
MKNNIPDAAAMDTGLSPNRPEMPAGPGDVPDRCADPASESGVPLHPPLFPIVGLGASAGG
LAAFEAFFSAIPPDLNTGMAFVLVQHLAPDHKSLLTELVKRYTGMRVQEVEDGMQVEPDC
IYIIPPSLDMALFQGTLRLLEPTVAQGRRLSIDFFFRSLALDQHERAIGVLLSGSGSDGT
LGARAIKGEGGLVMAQSPQTAAYDAMPRSVIATGLTDFVLPPAEMPAQLMAYVAHAFGKG
KRLSNATGRPEDALSKICILLRDRTGHDFSQYKQSTLIRRTERRMALHQIDHQGDYVRYL
QQSPGELDELFRDLLIGVTSFFRDPESFEVLERDVVPRLFAGKPSGAQVRVWVCGCSTGE
EAYSIAILLQEHLETLKQSFRVQVFATDVDARAIERARVGRYPASIAADVSEERLARYFS
RDPDGDGYRIQKGIRDLLIFSEQDVIKDPPFSRLDLISCRNLLIYFNGELQKRLMPIFHY
ALNPEGVLFLGNSETVGDSFSLFSPLNRKCKLFLRREHVFGVPAPAMSEFLSANVHVSHP
APSPTPRERRTTKVDLRVLTEQALLTHYSPVAILVNSRGDILHILGRTGQLLELPSGDTA
TNILSMARDGLARPLAAALHRSVARKEVVQVPDIRVDTQGDGVRVDLTVRPLRPDPSDNH
QSTSLYLVVFESPRSLAASEHLSEGEEPQPESERDRRIADLELELRAKEEYLQTTLEEME
TANEELKSTNEEMQSVNEELQSTNEELETSKEELQSVNEELATVNVELQNKVVDLSRANN
DMNNLLAGTGVATLFVDHHLRITRFTPTATHLIKLIQTDIGRSVGDIVSNLVNYTDLVED
TLAVLKTLVPREQEVQTQQGDWYLMRIGPYRTLENVIEGAVITFVDISGRKHMEDALRSA
RAMAEAIVDTVREPLLVLSEAWRVVSANRAFYCCFQVSPSEILNQPLFELGDGQWDIPAL
RRLLLEIQSTGASFEDYEVSHDFTGSGVRTMRLNARRIDPGDDRGGLILLAIEDLGAYHV
EANTASA
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaacataccggacgccgccgcgatggacactggcctgtcacccaatcgaccc
gaaatgccggccggcccgggcgatgtcccggatcgttgcgccgatccggcttccgagtcc
ggcgtcccgttgcacccgccgctctttccgatcgtcggtctcggcgcctcggccggcgga
ctcgccgccttcgaggcgttcttttcggccatcccgcccgatctgaacaccggcatggcc
ttcgtgctggtgcagcatctggcgcccgaccacaagagtctgctgaccgaactggtcaaa
cgctataccggcatgcgggtgcaggaggtcgaggatggcatgcaggtcgagccggactgt
atctatatcatcccgcccagtctcgacatggcgctgttccagggcacgctgcgtctgttg
gaacccacggtggcccagggacggcggctgtcgatcgacttcttcttccgttcgctggcg
ctcgatcagcacgaacgggcgatcggtgtcctgctctcgggctccggcagcgacggcacc
ctgggcgcgcgcgccatcaagggcgagggcggactggtcatggcccagtcgccccagaca
gcggcctacgacgccatgccgcgcagcgtcatcgccaccgggctgaccgatttcgtactg
ccgcccgccgagatgccggcccagctcatggcctatgtcgcccatgctttcggcaagggg
aagagactgagcaacgcgaccggccggcccgaggatgctctgagcaagatctgcatcctg
ctgcgcgaccgcaccggccatgacttctctcagtacaagcagagcaccctgatccgccgc
accgaacggcgcatggcgctgcaccagatcgaccaccagggcgattatgtccggtatctg
cagcaaagccccggcgaactcgatgagctcttccgcgacctgctgatcggtgtcaccagt
ttcttccgcgacccggagtccttcgaggtgctggagcgcgacgtcgttccgcgtctgttc
gccggcaaaccgtccggcgcccaggtgcgggtctgggtctgcggctgttcgaccggggaa
gaggcctactccatcgccatcctgttgcaagagcacctcgagaccctgaaacagagtttc
cgcgtccaggtgttcgccaccgatgtcgatgcgcgcgccatcgagcgggcacgggtcgga
cgctatccggccagcatcgccgccgatgtttcggaagaacgtctggcacgctatttttcg
cgcgatcccgacggcgacggctaccgcattcagaaaggcatccgcgatctgctgatcttc
tccgaacaggatgtgatcaaggatccgcccttctcgcgtctggatctgatcagttgccgc
aatctgctgatctatttcaatggcgagctgcaaaagcgcctgatgccgatctttcactac
gcactcaatccggagggtgtgctctttctgggcaactcggagaccgtcggcgactcgttc
agcctcttcagtccgctcaaccgcaagtgcaagctctttctgcggcgcgagcatgtgttc
ggggtgccggcgccggccatgagcgagttcctgagcgcgaacgtccatgtcagccatccg
gcgccgtcacccacgccgcgtgagcggcgcacgaccaaggtcgatctgcgcgtgctgacc
gaacaggctttgttgacgcactacagcccggtggccattctcgtcaacagccgtggcgac
atcctccatatcctgggccggaccggtcaactgctggagctgccttcgggtgacacggcc
accaatatcctgagcatggcccgcgacggtcttgcccgcccgctcgccgccgccctgcac
cggagtgtggcgcgcaaggaagtggtccaggttccggacatccgggtcgacacccagggt
gacggcgttcgcgtcgatctgaccgtgcgtccgttgcggccggatccgtccgacaaccat
cagtcgacgagcctctatctggtggtgttcgaatccccgcgctccctggccgcgtcggaa
catctcagcgagggagaggagccccagcctgagtcagagcgcgatcggcgcatcgccgat
ctggaactggaactgcgtgccaaggaggaatatctccagaccacgctggaggaaatggaa
accgctaacgaagagctgaaatcgaccaacgaggagatgcagtcggtcaatgaagagctg
caatcgaccaacgaggaactggagacctcgaaagaagagctgcaatcggtcaacgaggaa
ctggcgaccgtcaatgtcgagctacagaacaaggtcgtcgatctctcgcgtgccaacaac
gacatgaacaatctgctcgccggcaccggcgtggccacgctcttcgtcgaccatcacctg
cgcatcacccgttttacgcccacggccacccatctcatcaagctcatccagaccgacatc
gggcgctcggtgggggacatcgtttccaacctggtcaactatactgatctcgtggaggac
acgctggccgtgctcaagaccctggttccgcgcgagcaagaggtgcaaacgcaacagggc
gactggtatctgatgcgcatcggcccctatcgcaccctggagaacgtcatcgagggtgcg
gtgatcacctttgtcgatatctccggtcgtaaacacatggaagacgcgctgcgttcggca
cgagccatggccgaggcgatcgtggatacggtgcgcgagcccctgctggtgctgagcgag
gcctggcgggtggtatcggccaaccgggccttctactgctgtttccaggtcagtccgtcc
gaaatattgaatcagccgctgttcgagctgggcgatggtcaatgggacattccggcactg
cgccggctcctgctcgagatccagtcgaccggcgcctccttcgaagactacgaagtcagc
catgactttaccggcagcggggtgcgcaccatgcggctcaacgcccgccggatcgatccg
ggcgacgatcgtggcggtctgatcctgctggccattgaggatctcggggcatatcacgtc
gaagcgaatacggcaagcgcttga

DBGET integrated database retrieval system