KEGG   Allochromatium vinosum: Alvin_1182Help
Entry
Alvin_1182        CDS       T01168                                 

Definition
magnesium chelatase ATPase subunit I (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
alv  Allochromatium vinosum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:alv00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1369846..1370874
Genome map
AA seq 342 aa AA seqDB search
MPIPFPFSAVVAQEEMKRSLLMAAIDPSIGGVLVFGDRGTGKSTAIRGLAALLPKMRAVD
CTYNCDPEAGDDYLCQECRTKKAEKGSLKSRQVPVPVVDLPLGATEDRVIGALDLERALT
KGEKAFEPGLLARAHRGFLYIDEVNLLEDHLVDSLLDVAASGQNLVEREGLSVRHPARFV
LVGSGNPEEGELRPQLQDRFGLSVEVKTPTDLPTRMKVVRLRDEFERDPEAFVEKWKAKD
AKVSRQIQKAKKLLPEVEVPDRTLEETAKLCIKLGTDGLRGELTVIRSARALAALQGDKT
VTVDHVKTIAVSALRHRLRRDPLDESGSTSRVERAIKELFGE
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcccttttcccttttccgccgtcgtcgcccaggaggagatgaaacgctccctg
ctgatggcggccatcgatccctccatcggcggcgtgctcgtcttcggtgatcgtggcacg
ggtaagtccaccgccatccgtggactggccgccctgctgccgaagatgcgcgcggtcgac
tgcacctacaactgcgaccccgaggccggcgacgactacctgtgccaggagtgccgcacc
aagaaggccgagaaaggcagtctcaagagccggcaggtgcctgtgcccgtggtcgatctg
ccgctcggcgccaccgaagaccgcgtcatcggcgcactcgatctggagcgcgccctgacc
aagggcgagaaagccttcgagccgggcctgctggcgcgcgcccatcgcggcttcctctac
atcgacgaggtcaacctgctcgaagaccatctggtcgactcgctgctggacgtggccgcg
tccggtcagaacctggtcgagcgcgaggggttgagcgtgcgtcacccggcgcgcttcgtg
ctggtcggctcgggcaacccggaagagggcgaactgcgtccgcagttgcaggaccgtttc
ggcctttcggtcgaggtcaagacgcccaccgatctgcccacacgtatgaaggtcgtgcgt
ctgcgcgacgagttcgagcgtgatcccgaagccttcgtcgagaagtggaaggccaaggac
gccaaggtcagccgccagatccagaaggccaagaagctgctgcccgaggtcgaggtgccg
gatcggacgctcgaagagaccgccaagctctgcatcaagctcggcaccgacggtctgcgc
ggtgagctgaccgtgatccgctcggcgcgtgcgctcgccgcgctccagggcgacaagacc
gtcaccgtcgatcacgtcaagaccatcgccgtctcggcgctgcgccatcgtctgcgccgc
gatccgctcgacgagtccggctcgaccagccgtgtcgagcgcgcgatcaaggagctgttc
ggcgaatga

DBGET integrated database retrieval system