KEGG   Allochromatium vinosum: Alvin_1182Help
Entry
Alvin_1182        CDS       T01168                                 

Definition
(GenBank) magnesium chelatase ATPase subunit I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
alv  Allochromatium vinosum
Pathway
alv00860  Porphyrin and chlorophyll metabolism
alv01100  Metabolic pathways
alv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Alvin_1182
Enzymes [BR:alv01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Alvin_1182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_22 Sigma54_activat AAA_16 AAA_29 AAA DUF815 AAA_28
Motif
Other DBs
NCBI-ProteinID: ADC62121
JGI: Alvin_1182
UniProt: D3RSG2
Position
1369846..1370874
Genome map
AA seq 342 aa AA seqDB search
MPIPFPFSAVVAQEEMKRSLLMAAIDPSIGGVLVFGDRGTGKSTAIRGLAALLPKMRAVD
CTYNCDPEAGDDYLCQECRTKKAEKGSLKSRQVPVPVVDLPLGATEDRVIGALDLERALT
KGEKAFEPGLLARAHRGFLYIDEVNLLEDHLVDSLLDVAASGQNLVEREGLSVRHPARFV
LVGSGNPEEGELRPQLQDRFGLSVEVKTPTDLPTRMKVVRLRDEFERDPEAFVEKWKAKD
AKVSRQIQKAKKLLPEVEVPDRTLEETAKLCIKLGTDGLRGELTVIRSARALAALQGDKT
VTVDHVKTIAVSALRHRLRRDPLDESGSTSRVERAIKELFGE
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcccttttcccttttccgccgtcgtcgcccaggaggagatgaaacgctccctg
ctgatggcggccatcgatccctccatcggcggcgtgctcgtcttcggtgatcgtggcacg
ggtaagtccaccgccatccgtggactggccgccctgctgccgaagatgcgcgcggtcgac
tgcacctacaactgcgaccccgaggccggcgacgactacctgtgccaggagtgccgcacc
aagaaggccgagaaaggcagtctcaagagccggcaggtgcctgtgcccgtggtcgatctg
ccgctcggcgccaccgaagaccgcgtcatcggcgcactcgatctggagcgcgccctgacc
aagggcgagaaagccttcgagccgggcctgctggcgcgcgcccatcgcggcttcctctac
atcgacgaggtcaacctgctcgaagaccatctggtcgactcgctgctggacgtggccgcg
tccggtcagaacctggtcgagcgcgaggggttgagcgtgcgtcacccggcgcgcttcgtg
ctggtcggctcgggcaacccggaagagggcgaactgcgtccgcagttgcaggaccgtttc
ggcctttcggtcgaggtcaagacgcccaccgatctgcccacacgtatgaaggtcgtgcgt
ctgcgcgacgagttcgagcgtgatcccgaagccttcgtcgagaagtggaaggccaaggac
gccaaggtcagccgccagatccagaaggccaagaagctgctgcccgaggtcgaggtgccg
gatcggacgctcgaagagaccgccaagctctgcatcaagctcggcaccgacggtctgcgc
ggtgagctgaccgtgatccgctcggcgcgtgcgctcgccgcgctccagggcgacaagacc
gtcaccgtcgatcacgtcaagaccatcgccgtctcggcgctgcgccatcgtctgcgccgc
gatccgctcgacgagtccggctcgaccagccgtgtcgagcgcgcgatcaaggagctgttc
ggcgaatga

DBGET integrated database retrieval system