KEGG   Allochromatium vinosum: Alvin_1183Help
Entry
Alvin_1183        CDS       T01168                                 

Definition
magnesium chelatase ATPase subunit D
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
alv  Allochromatium vinosum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Alvin_1183
Enzymes [BR:alv01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Alvin_1183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1370871..1372691
Genome map
AA seq 606 aa AA seqDB search
MSTPGPNPAVADGGTPAPLQAGPGHSPWDDAVLAAVLMTIDPVGTGGVALRALPGPVRDQ
WLSIMRDLQPEGTPMRRIPLHVADGRLLGGLDLAATLNAGRPVAEKGLLVEADGGVVELA
MAERIAPGTAARLNMAFDSGEVVLERDGLAMRTPSRFAVVALDEGVGEDEGLLNALLDRL
AFHLELNYVRYDQAIACNYDVEDVLAARPRLPGVTITDTQVETLCNIALALGIPSLRASI
FASRVACAHAALEERTEVTDEDLAVAGRLVLAPRATQLPPMEPPPDAEPPPPEPEEPNQD
EEQSNQEPQEPQELQDKILDATKAAIPAGLLAQLQMGKLRRSRARATGKAGAVQNAPSRG
RPAGVLRGEPRAGQRLNVIETLRSAAPWQRIRREERARAGKPSNRLEIRQDDFRITRFKH
KSESTTIFVVDASGSSALHRLAEAKGAVELLLADCYVRRDQVALVAFRGQGAEVLLPPTR
SLVRAKRSLAGLPGGGGTPLASGIDLGMMLADGVQRRGGTPVLIVMTDGRANVARDGTGG
RTRANEEALAAARAVRSLEIPALVIDTSPRPQPQGRELAKEMGAVYLPLPHADANALNQA
VRATAG
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgagcacacccggcccgaatcccgctgtcgcggacggcggcacaccggccccgcttcag
gcgggtccgggccactcgccctgggacgatgccgtcctggccgccgtcctgatgacgatc
gatccggtcggtaccggcggcgtggcgctgcgtgcgctgcccggtccggtgcgcgatcag
tggctgtcgatcatgcgcgacctccagcccgagggcacgccgatgcggcgcattccgctg
catgtggccgatgggcgactgctcggcggtctggatctggccgccacgctcaatgccggg
cgtccggtggccgagaaagggctgctggtcgaggccgatggcggtgtcgtcgagctggcg
atggccgagcgcatcgcgcccggcacggccgcgcggctcaacatggccttcgactcgggc
gaggtggtcctggaacgcgatgggctggccatgcgcacgccgtcgcgcttcgccgtggtc
gcgctcgacgagggcgtgggcgaggacgagggactgttgaacgcgctgctcgaccggctg
gccttccatctggaactcaactacgtccgctacgatcaggccatcgcctgtaactacgac
gttgaggacgtgctcgccgcgcgaccgcgtctgcccggcgtcacgatcaccgatacccag
gtcgagaccctgtgcaatatcgcgctggcgctcggcatcccctcgctgcgcgcctcgatc
ttcgccagccgcgtggcctgtgcccatgccgcgctcgaagaacgcaccgaagtgaccgac
gaggatctcgccgtcgctggacgtctggtgctcgctccgcgcgcgacccagctcccgccg
atggagccgccgccggacgccgaaccgccgccgcccgagccggaagagccgaatcaggac
gaggaacagtccaaccaggagccgcaggaaccccaggagcttcaggacaagatcctggac
gccaccaaggcggcgatcccggccggtctgctggcccagctccagatgggcaagctgcgc
cgctcgcgcgcgcgcgccaccggcaaggcgggggcagtccagaatgcgccctcgcgcgga
cggccggctggggtgctgcgcggcgagccgcgtgccggacagcggttgaacgtgatcgaa
accctgcgttccgccgcgccctggcagcgcatccgccgcgaggaacgcgcgcgcgccggc
aagccgtccaaccggctcgaaatccgtcaggacgacttccgcatcacccgcttcaagcac
aagtccgagagcacgaccatcttcgtggtcgatgcctccggctcttcggcgctgcaccgt
ctggccgaggccaagggtgcggtcgagctgctgctggccgactgctatgtgcggcgcgat
caggtcgcgctggtggcgttccgggggcagggggccgaggtgctgctgccgccgacgcgc
tcgctggtgcgtgccaagcgcagtctggccgggctgccgggcggcggcggcacgccgctg
gcctcgggcatcgacctggggatgatgctggccgatggcgtgcagcgtcgcggcggcacc
ccggtgctgatcgtcatgaccgacggtcgggccaatgtcgcgcgcgacggtacgggcggg
cgcacgcgcgccaacgaggaagcgctggccgccgcgcgcgcggtacgctcgctggagatc
cccgcactggtgatcgacacctcgccgcgtccgcagccgcaggggcgtgaactggccaag
gaaatgggcgcggtctatctgccgctgccgcatgccgatgccaacgcgctcaatcaggcc
gtgcgggcgacggcgggctga

DBGET integrated database retrieval system