KEGG   Allochromatium vinosum: Alvin_1215Help
Entry
Alvin_1215        CDS       T01168                                 

Definition
DNA polymerase III subunit chi HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
alv  Allochromatium vinosum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Alvin_1215
   00240 Pyrimidine metabolism
    Alvin_1215
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Alvin_1215
   03430 Mismatch repair
    Alvin_1215
   03440 Homologous recombination
    Alvin_1215
Enzymes [BR:alv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Alvin_1215
DNA replication proteins [BR:alv03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Alvin_1215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1403179..1403610)
Genome map
AA seq 143 aa AA seqDB search
MTRVDFYSLEPDSRGDRFILACRLVERIRAQDLRVLILCPDREEARHLDRLLWTMRQESF
LPHGLVGTVDTDLTPILISLDGASEHGCPVLLNLSRALPAGLERFERLCDLVDNDPAVRQ
AGRERFRAYRERGYEPDHHKIRL
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
gtgactcgagtcgatttctacagtctcgaacccgacagccggggtgatcgcttcatcctg
gcctgtcggctcgtcgagcgtatccgcgcccaggatctgcgcgtactcatcctctgcccc
gatcgcgaggaggcgcgccatctcgaccgtctgctctggaccatgcggcaggagagtttc
ctgccgcatggtctggtcgggacagtggatacggacctgacccccatcctcatcagcctg
gacggcgcctcggaacacggctgcccggtgctcctcaatctctcacgcgcactgccggcg
ggattggaacgcttcgaacggctgtgcgatctggtcgacaacgacccggcggtgcgtcag
gccggacgcgagcgttttcgggcgtatcgcgaacgcggctacgaacccgatcaccacaag
attcggttatag

DBGET integrated database retrieval system