KEGG   Allochromatium vinosum: Alvin_1326Help
Entry
Alvin_1326        CDS       T01168                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
alv  Allochromatium vinosum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Alvin_1326
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alvin_1326
   00052 Galactose metabolism
    Alvin_1326
   00500 Starch and sucrose metabolism
    Alvin_1326
   00520 Amino sugar and nucleotide sugar metabolism
    Alvin_1326
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Alvin_1326
   00524 Butirosin and neomycin biosynthesis
    Alvin_1326
Enzymes [BR:alv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Alvin_1326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1514178..1515158
Genome map
AA seq 326 aa AA seqDB search
MRLLVGDIGGTKTALGLAETDGGSVRLGETRRYPSASFGSLDQIVQRYLLETGATCRFAV
FAVAGPIHDRRCETTNLPWVLDAEALEQSLGLTCVELLNDLEAVAWGVPILSSDDLAELH
PGDPCSQGNACVVAAGTGLGQAGLFWDGLRHHAFATEGGHSDFAPADDLEFALLTYLKSR
FGRVSWERVVSGPGIVNLFDFLRFHHSVQAPDWLQAVIDTGGDTAATIAQAAADDRCPLC
RETLNLFMRLYGREAGNAALKHMALGGVYLGGGIALKNLACLRRGGFLEGFFDKGRMGSL
MRRMPVRVILQPNTPLLGAARFMALQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgttggtaggtgacatcggtggcacgaagacggcccttggcctggccgagacg
gatggcgggtccgtgcgtctcggagagacccggcgctatcccagcgcgtccttcggctcg
ctcgatcagatcgtgcagcgttatctgctcgaaacgggcgccacatgccggttcgcggtc
tttgccgtcgccggccccatccatgatcggcgctgcgagacgaccaatctgccctgggtg
ctggacgccgaggccctggagcagagcctgggtctgacctgtgtggaactgctcaacgat
ctggaagccgtcgcctggggtgtacccatcctcagctcggacgatctggccgaactccac
cccggcgatccgtgcagtcagggtaacgcctgtgtcgtggccgccgggaccggactcgga
caggcggggctgttctgggatggactgcgtcatcatgcctttgccaccgaaggcggacac
tcggacttcgccccggccgacgatctggagttcgcgctgctgacctatctcaagtcgcgc
ttcgggcgtgtgagttgggagcgggtcgtctcgggtccggggatcgtcaatctgttcgat
ttcctgcgtttccatcacagtgtccaggcgcctgactggctgcaagcggtcatcgacacc
ggaggcgacacggcggccaccatcgcccaggccgccgccgacgatcggtgtccgctgtgc
cgcgagacactgaatctcttcatgcgtctttatggacgcgaggccggcaatgcggcgctc
aagcacatggcgctcggcggagtctatctgggcggcggcatcgccctgaagaatctggcc
tgtctgcgtcggggcggtttcctggaagggttcttcgacaaggggcgcatgggctcgctg
atgcggcgcatgccggtgcgcgtcatcctgcaacccaacaccccgctgctcggtgcggcg
cgcttcatggccttgcaatga

DBGET integrated database retrieval system