KEGG   Allochromatium vinosum: Alvin_1505Help
Entry
Alvin_1505        CDS       T01168                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
alv  Allochromatium vinosum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Alvin_1505
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Alvin_1505
   00640 Propanoate metabolism
    Alvin_1505
   00660 C5-Branched dibasic acid metabolism
    Alvin_1505
Enzymes [BR:alv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Alvin_1505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1745388..1746596
Genome map
AA seq 402 aa AA seqDB search
MNLHEFQAKQLLRERGLAVPDGVLVERPEAARDACVQLGGTRWAVKAQIHSGGRGKAGGV
VLVDSPEQAESETRRLLGSRLVTLQSGPDGLPVGSVLIERPTAIARELYLSLLVDRASER
LLFVASAAGGMDIETVAAETPERILKVALHPVVGFQPYKARRLGFGLGLDESQIKALGTL
MDGLYRLFVDTDASLIEINPLVVTDTGELLALDAKITLDDNALMRHPALAALRDPSQEDP
REAAARAHDLNYISLDGNIGCMVNGAGLAMATMDLIKLQGGRPANFLDVGGGATAARVAE
AFKLILSDPKVASILVNIFGGIVRCDLIAEGIIQAVREVGVSVPIVVRLEGTNAPQGLQL
LADSGLALQTAGELDAAATLAVEAARRGIGASSNTVEEEGRP
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacgaatttcaagccaaacagttgttgcgggagcgcggactcgcggtcccg
gatggagtcctggtcgagcgtcccgaggccgcacgcgacgcctgcgttcagctcggcggc
acgcgctgggcggtcaaggcgcagatccacagcggcggtcgcggcaaggctgggggcgta
gtgctggtcgacagtcccgagcaggccgagagcgagacgcgccgtctgctcggctcacgg
ctcgtcacgctccagagcgggccggacgggctgccggtcggatcagtcctgatcgaacgc
ccgaccgccatcgcgcgcgagctctatctgagtctgctggtcgatcgcgccagcgagcgg
ttgctgttcgtcgcctcggcggccggcggcatggacatcgagacggtggcggccgaaacg
cccgagcggattctcaaggtcgcgctgcatccggtggtcggcttccagccttacaaggcg
cgccggctcggcttcgggctgggattggacgaaagccagatcaaggcgctcggtacgctg
atggatggactctatcggctcttcgtcgacacggacgccagcctgatcgagatcaatccg
ctggtcgtcaccgacacgggcgagctgctggcgctcgatgccaagatcacgctcgacgac
aacgcgctcatgcgtcatccggcactggccgcactccgcgacccgagtcaggaagacccg
cgcgaggcggcggcgcgggcgcacgatctcaactacatcagtctcgacggcaacatcggc
tgtatggtcaatggggctgggctggcgatggcgaccatggatctgatcaagctccagggc
ggacggccggccaacttcctcgatgtcggcggcggggcgacggcggcgcgcgtggccgag
gcgttcaagctcattctctccgaccccaaggtcgcctcgatcctggtcaacatcttcggc
ggtatcgtgcgctgtgacctgatcgccgaggggatcatccaggcggtgcgcgaggttggg
gtgtcggtgccgatcgtggtgcgcctggaaggcaccaatgcgccgcaggggttgcaactg
ctcgccgacagcgggctggcgcttcagacggccggcgaactcgacgcggccgcgacactg
gcggtcgaagccgcgcggcgtggtatcggcgcatcatcgaacaccgtggaagaggagggc
cgcccatga

DBGET integrated database retrieval system