KEGG   Allochromatium vinosum: Alvin_1505Help
Entry
Alvin_1505        CDS       T01168                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
alv  Allochromatium vinosum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Alvin_1505
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Alvin_1505
   00640 Propanoate metabolism
    Alvin_1505
   00660 C5-Branched dibasic acid metabolism
    Alvin_1505
Enzymes [BR:alv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Alvin_1505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1745388..1746596
Genome map
AA seq 402 aa AA seqDB search
MNLHEFQAKQLLRERGLAVPDGVLVERPEAARDACVQLGGTRWAVKAQIHSGGRGKAGGV
VLVDSPEQAESETRRLLGSRLVTLQSGPDGLPVGSVLIERPTAIARELYLSLLVDRASER
LLFVASAAGGMDIETVAAETPERILKVALHPVVGFQPYKARRLGFGLGLDESQIKALGTL
MDGLYRLFVDTDASLIEINPLVVTDTGELLALDAKITLDDNALMRHPALAALRDPSQEDP
REAAARAHDLNYISLDGNIGCMVNGAGLAMATMDLIKLQGGRPANFLDVGGGATAARVAE
AFKLILSDPKVASILVNIFGGIVRCDLIAEGIIQAVREVGVSVPIVVRLEGTNAPQGLQL
LADSGLALQTAGELDAAATLAVEAARRGIGASSNTVEEEGRP
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacgaatttcaagccaaacagttgttgcgggagcgcggactcgcggtcccg
gatggagtcctggtcgagcgtcccgaggccgcacgcgacgcctgcgttcagctcggcggc
acgcgctgggcggtcaaggcgcagatccacagcggcggtcgcggcaaggctgggggcgta
gtgctggtcgacagtcccgagcaggccgagagcgagacgcgccgtctgctcggctcacgg
ctcgtcacgctccagagcgggccggacgggctgccggtcggatcagtcctgatcgaacgc
ccgaccgccatcgcgcgcgagctctatctgagtctgctggtcgatcgcgccagcgagcgg
ttgctgttcgtcgcctcggcggccggcggcatggacatcgagacggtggcggccgaaacg
cccgagcggattctcaaggtcgcgctgcatccggtggtcggcttccagccttacaaggcg
cgccggctcggcttcgggctgggattggacgaaagccagatcaaggcgctcggtacgctg
atggatggactctatcggctcttcgtcgacacggacgccagcctgatcgagatcaatccg
ctggtcgtcaccgacacgggcgagctgctggcgctcgatgccaagatcacgctcgacgac
aacgcgctcatgcgtcatccggcactggccgcactccgcgacccgagtcaggaagacccg
cgcgaggcggcggcgcgggcgcacgatctcaactacatcagtctcgacggcaacatcggc
tgtatggtcaatggggctgggctggcgatggcgaccatggatctgatcaagctccagggc
ggacggccggccaacttcctcgatgtcggcggcggggcgacggcggcgcgcgtggccgag
gcgttcaagctcattctctccgaccccaaggtcgcctcgatcctggtcaacatcttcggc
ggtatcgtgcgctgtgacctgatcgccgaggggatcatccaggcggtgcgcgaggttggg
gtgtcggtgccgatcgtggtgcgcctggaaggcaccaatgcgccgcaggggttgcaactg
ctcgccgacagcgggctggcgcttcagacggccggcgaactcgacgcggccgcgacactg
gcggtcgaagccgcgcggcgtggtatcggcgcatcatcgaacaccgtggaagaggagggc
cgcccatga

DBGET integrated database retrieval system