KEGG   Allochromatium vinosum: Alvin_1505Help
Entry
Alvin_1505        CDS       T01168                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
alv  Allochromatium vinosum
Pathway
alv00020  Citrate cycle (TCA cycle)
alv00640  Propanoate metabolism
alv00660  C5-Branched dibasic acid metabolism
alv01100  Metabolic pathways
alv01110  Biosynthesis of secondary metabolites
alv01120  Microbial metabolism in diverse environments
alv01130  Biosynthesis of antibiotics
alv01200  Carbon metabolism
Module
alv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
alv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Alvin_1505
   00640 Propanoate metabolism
    Alvin_1505
   00660 C5-Branched dibasic acid metabolism
    Alvin_1505
Enzymes [BR:alv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Alvin_1505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Peripla_BP_3
Motif
Other DBs
NCBI-ProteinID: ADC62438
JGI: Alvin_1505
UniProt: D3RTC9
Position
1745388..1746596
Genome map
AA seq 402 aa AA seqDB search
MNLHEFQAKQLLRERGLAVPDGVLVERPEAARDACVQLGGTRWAVKAQIHSGGRGKAGGV
VLVDSPEQAESETRRLLGSRLVTLQSGPDGLPVGSVLIERPTAIARELYLSLLVDRASER
LLFVASAAGGMDIETVAAETPERILKVALHPVVGFQPYKARRLGFGLGLDESQIKALGTL
MDGLYRLFVDTDASLIEINPLVVTDTGELLALDAKITLDDNALMRHPALAALRDPSQEDP
REAAARAHDLNYISLDGNIGCMVNGAGLAMATMDLIKLQGGRPANFLDVGGGATAARVAE
AFKLILSDPKVASILVNIFGGIVRCDLIAEGIIQAVREVGVSVPIVVRLEGTNAPQGLQL
LADSGLALQTAGELDAAATLAVEAARRGIGASSNTVEEEGRP
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacgaatttcaagccaaacagttgttgcgggagcgcggactcgcggtcccg
gatggagtcctggtcgagcgtcccgaggccgcacgcgacgcctgcgttcagctcggcggc
acgcgctgggcggtcaaggcgcagatccacagcggcggtcgcggcaaggctgggggcgta
gtgctggtcgacagtcccgagcaggccgagagcgagacgcgccgtctgctcggctcacgg
ctcgtcacgctccagagcgggccggacgggctgccggtcggatcagtcctgatcgaacgc
ccgaccgccatcgcgcgcgagctctatctgagtctgctggtcgatcgcgccagcgagcgg
ttgctgttcgtcgcctcggcggccggcggcatggacatcgagacggtggcggccgaaacg
cccgagcggattctcaaggtcgcgctgcatccggtggtcggcttccagccttacaaggcg
cgccggctcggcttcgggctgggattggacgaaagccagatcaaggcgctcggtacgctg
atggatggactctatcggctcttcgtcgacacggacgccagcctgatcgagatcaatccg
ctggtcgtcaccgacacgggcgagctgctggcgctcgatgccaagatcacgctcgacgac
aacgcgctcatgcgtcatccggcactggccgcactccgcgacccgagtcaggaagacccg
cgcgaggcggcggcgcgggcgcacgatctcaactacatcagtctcgacggcaacatcggc
tgtatggtcaatggggctgggctggcgatggcgaccatggatctgatcaagctccagggc
ggacggccggccaacttcctcgatgtcggcggcggggcgacggcggcgcgcgtggccgag
gcgttcaagctcattctctccgaccccaaggtcgcctcgatcctggtcaacatcttcggc
ggtatcgtgcgctgtgacctgatcgccgaggggatcatccaggcggtgcgcgaggttggg
gtgtcggtgccgatcgtggtgcgcctggaaggcaccaatgcgccgcaggggttgcaactg
ctcgccgacagcgggctggcgcttcagacggccggcgaactcgacgcggccgcgacactg
gcggtcgaagccgcgcggcgtggtatcggcgcatcatcgaacaccgtggaagaggagggc
cgcccatga

DBGET integrated database retrieval system