KEGG   Allochromatium vinosum: Alvin_1600Help
Entry
Alvin_1600        CDS       T01168                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
alv  Allochromatium vinosum
Pathway
alv00260  Glycine, serine and threonine metabolism
alv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
alv01100  Metabolic pathways
alv01110  Biosynthesis of secondary metabolites
alv01130  Biosynthesis of antibiotics
alv01230  Biosynthesis of amino acids
Module
alv_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Alvin_1600
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Alvin_1600
Enzymes [BR:alv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Alvin_1600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ADC62533
JGI: Alvin_1600
UniProt: D3RTM4
Position
complement(1859933..1860742)
Genome map
AA seq 269 aa AA seqDB search
MSRIAQRFEQLKAQGRTALVPFVTAGDPGPATTVPLMHAMVAAGADIIELGVPFSDPMAD
GPVIQRATERALAQGVRLADVLEMVRAFRERDDETPVVLMGYLNPIEIMGYAAFAERAQA
AGVDGALIVDVPPEEGHELVGTLKEQGLDLVYLLAPTSTDDRIKRIGGVASGFVYYVSVK
GVTGAANLDTADVAEHLARIRSAVALPVGVGFGIRDAETAARVAEVADAVIVGSAIVGRI
EALAETPERIPETVAAFLAELRTAIDGAR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcatcgcacagcgtttcgaacaactgaaggcgcagggtcgtaccgcgctggtt
cccttcgtcaccgccggcgatccgggaccggcgaccacggtgccgctgatgcacgccatg
gtcgcggccggcgccgacatcatcgaactgggcgtgcccttctccgatcccatggccgat
ggtccggtgatccagcgcgccaccgaacgggcgctggctcagggtgtgcggctggccgac
gtgctggagatggtgcgtgcgttccgcgagcgcgacgacgagacgcccgtggtgctcatg
ggctatctcaatccaatcgagatcatgggctatgccgcgttcgccgagcgggcgcaggcc
gccggggtcgatggtgcactgatcgtcgatgtgccgcccgaagaggggcatgagctggtc
gggacgctcaaggaacaggggctggatctggtctatctgctcgcgccgacctcgaccgat
gatcgaatcaagcgtatcggtggcgtggcctcgggcttcgtctattacgtctcggtcaag
ggcgtgaccggcgcggcgaatctcgacacggcggatgtggccgagcatctggcgcgtatc
cggtcggcggtcgcgcttccggtcggggtcggcttcggcatccgcgatgccgagaccgcc
gcgcgcgtggccgaggtcgccgatgccgtgatcgtcggcagcgccatcgtcgggcggatc
gaagcactcgccgagacgcccgagcgcatccccgagacggtcgcggccttcctggccgag
ctgcgcacggcgatcgacggcgcgcgctga

DBGET integrated database retrieval system