KEGG   Allochromatium vinosum: Alvin_1601Help
Entry
Alvin_1601        CDS       T01168                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
alv  Allochromatium vinosum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Alvin_1601
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Alvin_1601
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Alvin_1601
Enzymes [BR:alv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Alvin_1601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1860739..1861989)
Genome map
AA seq 416 aa AA seqDB search
MAINADTSQAERLDPGRAAAYDLPDAAGHFGPYGGLFVPETLMHPLEELRLAYERCKADP
EFQSEMDADLRDYVGRPSPLYHAERWSRELGGAQIYLKREDLNHTGAHKVNNTIGQALLA
KRMGKTRIIAETGAGQHGVASATVAARLGLECVVYMGEVDVARQEANVYRMRLLGARVVP
VTSGSRTLKDAMNEAMRDWVTNIDDTFYIIGTVAGPHPYPMMVRDFQTVIGREARAQMLE
RTGRLPDALVACVGGGSNALGLFHPFIADTDVAIYGVEAGGEGVETGRHAAPLCAGRPGV
LHGNRTYLMEDDNGQIIETHSISAGLDYPGVGPEHAWLKDSGRAQYAAVTDDEALAAFHH
LTRTEGIIPALESSHALAYAHKLAPTLRPDQSILVNLSGRGDKDMHTVARHDGLVL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaacgccgacaccagccaggctgagcgcctggatccaggccgcgcggcggcc
tatgacctgccggatgcggcgggacacttcggtccctatggcgggctgttcgtgcccgag
acgctgatgcatccgctggaagagctgcggctggcctatgagcgctgcaaggccgatccc
gagttccagtccgagatggacgccgatctgcgcgactacgtcggtcggccttcgccgctc
tatcacgccgagcgctggagccgtgagctgggcggggcgcagatctatctcaagcgcgag
gatctcaaccacacgggcgcgcacaaggtcaacaacaccatcggtcaggcgctactggcc
aagcgcatgggcaagacgcgcatcatcgccgagaccggcgccggtcagcatggcgtggcg
agcgccacggtcgccgcgcggctggggctggaatgcgtggtctacatgggcgaggtcgac
gtcgcgcgtcaggaggccaatgtctaccggatgcggctgctcggcgccagggtcgtgcct
gtgacgtccggttcgcgcaccctcaaggatgcgatgaacgaagccatgcgtgactgggtg
acgaacatcgacgacaccttctacatcatcggcaccgtcgccgggccgcatccctatccg
atgatggtgcgcgacttccagaccgtgatcggtcgcgaggcgcgcgcccagatgctggaa
cgcaccggacgcctgcccgatgcgctggtggcctgtgtcggcggcggctcgaacgccctc
ggtctgttccatcccttcatcgcggacacggacgtggcgatctatggagtcgaagcaggc
ggggagggcgtcgagaccggccggcacgccgcccccctgtgcgccggacgtcccggcgtg
ctgcacggcaaccgcacctatctgatggaagacgacaacggccagatcatcgagacccac
tcgatctcggccggactcgactatccgggcgtcggtcccgaacatgcgtggctcaaggac
agcgggcgtgctcagtacgctgccgtcacggatgacgaggcgctcgccgccttccatcat
ctcacgcgcaccgagggcatcatcccggcgctcgaatcgagccatgcgctcgcctatgca
cacaagctcgcgccgaccctgcgtcccgaccagagcatcctggtcaatctctccggtcgc
ggagacaaggacatgcacacggtcgcgcgtcacgacgggttggtcctatga

DBGET integrated database retrieval system