KEGG   Allochromatium vinosum: Alvin_1601Help
Entry
Alvin_1601        CDS       T01168                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
alv  Allochromatium vinosum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Alvin_1601
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Alvin_1601
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Alvin_1601
Enzymes [BR:alv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Alvin_1601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1860739..1861989)
Genome map
AA seq 416 aa AA seqDB search
MAINADTSQAERLDPGRAAAYDLPDAAGHFGPYGGLFVPETLMHPLEELRLAYERCKADP
EFQSEMDADLRDYVGRPSPLYHAERWSRELGGAQIYLKREDLNHTGAHKVNNTIGQALLA
KRMGKTRIIAETGAGQHGVASATVAARLGLECVVYMGEVDVARQEANVYRMRLLGARVVP
VTSGSRTLKDAMNEAMRDWVTNIDDTFYIIGTVAGPHPYPMMVRDFQTVIGREARAQMLE
RTGRLPDALVACVGGGSNALGLFHPFIADTDVAIYGVEAGGEGVETGRHAAPLCAGRPGV
LHGNRTYLMEDDNGQIIETHSISAGLDYPGVGPEHAWLKDSGRAQYAAVTDDEALAAFHH
LTRTEGIIPALESSHALAYAHKLAPTLRPDQSILVNLSGRGDKDMHTVARHDGLVL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaacgccgacaccagccaggctgagcgcctggatccaggccgcgcggcggcc
tatgacctgccggatgcggcgggacacttcggtccctatggcgggctgttcgtgcccgag
acgctgatgcatccgctggaagagctgcggctggcctatgagcgctgcaaggccgatccc
gagttccagtccgagatggacgccgatctgcgcgactacgtcggtcggccttcgccgctc
tatcacgccgagcgctggagccgtgagctgggcggggcgcagatctatctcaagcgcgag
gatctcaaccacacgggcgcgcacaaggtcaacaacaccatcggtcaggcgctactggcc
aagcgcatgggcaagacgcgcatcatcgccgagaccggcgccggtcagcatggcgtggcg
agcgccacggtcgccgcgcggctggggctggaatgcgtggtctacatgggcgaggtcgac
gtcgcgcgtcaggaggccaatgtctaccggatgcggctgctcggcgccagggtcgtgcct
gtgacgtccggttcgcgcaccctcaaggatgcgatgaacgaagccatgcgtgactgggtg
acgaacatcgacgacaccttctacatcatcggcaccgtcgccgggccgcatccctatccg
atgatggtgcgcgacttccagaccgtgatcggtcgcgaggcgcgcgcccagatgctggaa
cgcaccggacgcctgcccgatgcgctggtggcctgtgtcggcggcggctcgaacgccctc
ggtctgttccatcccttcatcgcggacacggacgtggcgatctatggagtcgaagcaggc
ggggagggcgtcgagaccggccggcacgccgcccccctgtgcgccggacgtcccggcgtg
ctgcacggcaaccgcacctatctgatggaagacgacaacggccagatcatcgagacccac
tcgatctcggccggactcgactatccgggcgtcggtcccgaacatgcgtggctcaaggac
agcgggcgtgctcagtacgctgccgtcacggatgacgaggcgctcgccgccttccatcat
ctcacgcgcaccgagggcatcatcccggcgctcgaatcgagccatgcgctcgcctatgca
cacaagctcgcgccgaccctgcgtcccgaccagagcatcctggtcaatctctccggtcgc
ggagacaaggacatgcacacggtcgcgcgtcacgacgggttggtcctatga

DBGET integrated database retrieval system