KEGG   Allochromatium vinosum: Alvin_1848Help
Entry
Alvin_1848        CDS       T01168                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
alv  Allochromatium vinosum
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Alvin_1848
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Alvin_1848
Enzymes [BR:alv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Alvin_1848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2123092..2124399)
Genome map
AA seq 435 aa AA seqDB search
MNRQDQIQAIERDWAENPRWTDVERGYSAADVVRLRGSVQPEYTYAKLGAEKLWKRIRGE
SKKGYVNCMGAITGGQAMQQAKAGIEAIYLSGWQVAADGNTSETMYPDQSLYAYDSVPTM
VRRINNSFKRADEIQWSRGIGPGDEGYIDYFLPIVADAEAGFGGVLNAFELMKNMIANGA
AGVHFEDQLAAVKKCGHMGGKVLVPTREAVQKLIAARLAADVMGVPTLLLARTDAEAANL
LTSDVDDNDRPFVTGARTDEGFYVVKNGLEQAISRGLAYAPYADLVWCETGTPDLGFARE
FAQAVLGANPNKLLAYNCSPSFNWKKNLDDRTIARFQEELADMGYKYQFITLAGIHSMWY
NMFDLAYDYARGEGMRHYVEKVQGPEFAAREKGYTFVSHQQEVGAGYFDDVTTVIQGGQS
SVTALTGSTEEEQFH
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgccaagatcagatccaggccatcgaacgtgactgggccgagaacccccgctgg
accgatgtcgagcgcggctacagcgccgccgacgtggtgcgtctgcgcggctcggtgcag
cccgagtacacctacgccaagctgggcgccgagaagctctggaagcggatccgtggcgag
tccaaaaagggctatgtcaactgcatgggcgccatcaccggcggtcaggcgatgcagcag
gccaaggccggcatcgaggccatctatctctcgggctggcaggtcgccgccgacggcaac
acctccgagaccatgtaccccgaccagtcgctctacgcctatgactcggtcccgaccatg
gtgcggcgcatcaacaacagcttcaagcgcgccgacgagatccagtggtcgcgcggcatc
ggtcccggcgacgagggctacatcgactacttcctgccgatcgtggccgatgccgaggcc
ggtttcggcggcgtgctcaacgctttcgagctgatgaagaacatgatcgccaatggcgcc
gccggtgtccatttcgaggatcagctcgcggcggtcaagaagtgcggtcacatgggcggc
aaggtgctggtgcccacgcgcgaggcggtgcagaagctgatcgcggcgcgtctggctgcc
gacgtcatgggcgtgccgaccctgctgctggcgcgcaccgatgccgaggcggccaacctg
ctcaccagcgatgtcgacgacaacgaccgtcccttcgtcaccggcgcgcgcaccgatgag
ggcttctatgtcgtcaagaacggtctggagcaggccatcagtcgcggactggcctatgcg
ccctatgccgatctggtgtggtgtgagaccggcacgccggatctcgggtttgcgcgtgag
ttcgctcaagccgtgctgggcgcgaatcccaacaaactactggcctacaactgttcgccc
tcgttcaactggaagaagaacctggacgatcgcaccatcgcgcgattccaggaagagctg
gccgacatgggctacaagtaccagttcatcacgctcgccggcattcacagcatgtggtac
aacatgttcgatctggcctacgactatgcgcgcggcgagggcatgcgccactatgtcgag
aaggtccaggggccggagttcgccgcgcgcgagaagggttacaccttcgtctcgcatcag
caggaagtgggcgccggttacttcgacgacgtgaccacggtcatccagggcggtcagtcg
tccgtcacggcgctgaccggctcgaccgaggaagagcagttccactga

DBGET integrated database retrieval system