KEGG   Allochromatium vinosum: Alvin_1898Help
Entry
Alvin_1898        CDS       T01168                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
alv  Allochromatium vinosum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Alvin_1898
Enzymes [BR:alv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Alvin_1898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2174833..2175345
Genome map
AA seq 170 aa AA seqDB search
MSQETRAFIAIGSNIEPERHIALGLEALSQIPTTRIGAVSSWYRTRPWGLEAQAEFINLV
VEVWTRLTPSALLAATQGVENRLGRIRAQVNGPRTLDLDILLYGERVDDMPELRLPHPGL
LLRDFMLIPLLEIAPEVMHPERGHPIAELTDEIRYHQIIDRIPDASQAHG
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggagacgcgcgccttcatcgccatcggttcgaacatcgaacccgagcgccac
atcgcgctcggactggaggcgctgagccagatcccgacgacccggatcggggcggtctcg
tcgtggtatcgcacccgcccctgggggctggaagcgcaggcggagttcatcaatctggtg
gtggaagtctggacgcggctgacgccgtcggcgctgctggccgcgactcagggggtcgag
aatcggcttggacggatacgcgcgcaggtcaatggtccgcgcacgctcgatctcgacatc
ctgctgtatggtgagcgcgtcgacgacatgccggagctaaggctaccgcaccccggcctt
ctgttacgtgacttcatgctgatccccttgctggagatcgcgcccgaggtcatgcatccc
gagcgcggacaccccatcgccgagctgacggacgagatccgttaccatcaaatcattgat
cggattccggacgcctctcaggctcacgggtag

DBGET integrated database retrieval system