KEGG   Allochromatium vinosum: Alvin_1962Help
Entry
Alvin_1962        CDS       T01168                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
alv  Allochromatium vinosum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Alvin_1962
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Alvin_1962
   00650 Butanoate metabolism
    Alvin_1962
  Energy metabolism
   00190 Oxidative phosphorylation
    Alvin_1962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2246900..2247244)
Genome map
AA seq 114 aa AA seqDB search
MSRQASGLMAWLLQRTTAIYLSFLAGYLLLKFIFDAPADHAELVAWVAHPLVAMALMLGV
PLVLAHAWVGIRDVLIDYVRLTNLRVGLMTWFVFIIVASGLWFVKAIITAGIGG
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtcaagcatccggactcatggcctggctgttgcagcgcaccacggccatttat
ctgtcctttctcgcgggctatctgctgctcaaattcatcttcgacgcccccgccgaccac
gccgaactggtggcctgggtggcgcatccgctggtcgccatggcgctgatgctcggcgtg
ccgctggtgctcgcccatgcctgggtcggcatccgcgacgtgctgatcgattatgtgcgt
ctcaccaatctgcgcgtgggtctcatgacctggttcgtcttcatcatcgtcgcctccgga
ctctggttcgtgaaggcgatcatcactgccggcatcgggggttga

DBGET integrated database retrieval system