KEGG   Allochromatium vinosum: Alvin_2021Help
Entry
Alvin_2021        CDS       T01168                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
alv  Allochromatium vinosum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Alvin_2021
Enzymes [BR:alv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Alvin_2021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2318653..2320167)
Genome map
AA seq 504 aa AA seqDB search
MHRTSGLLLHPTSLPSHYGIGDLGPSARRFVDFLAAAGQGLWQMLPLGPTGYRDSPYQCT
SAFAANPLLISPDGLLEFGWLQASDLDGRPAFPEDRVDFGAVAPWKTRLLALARAGFAER
AGEDDRADYARFCTREAFWLDDYALYHALKTHHELRPWTDWEPALAQRDPDALGDWSARH
RDEVELQRFVQYVFHRQWSSLRDYARVRGVRLIGDIPIFVAHDSSEVWTHPEWFELDERG
HPTVIAGVPPDYFSATGQRWGNPLYRWPVLAADGYRFWIERLRRSLELVDLVRIDHFRGF
AGYWEIPASEETAINGRWVPGPGLAFFQALRAALGENLPLIAEDLGVITEDVEALRDTLE
LPGMAVLQFGFEDLEDGFGGSSFLPHRHRRRLAVYTGTHDNNTLLGWWAERNEHLRAQVL
AYLNGDGQAVNWDFIRVALGSVADLALFPMQDVLNLGGEACMNRPGTAEGNWLWRYREDQ
LDPAAAERLLRLSRLYGRRPYEPG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcaccagcggcctcctgcttcatccgacttcgctgccgagtcactatggaatc
ggcgatcttggcccaagcgcacgccgtttcgtcgatttcctcgccgcagcggggcagggg
ctctggcagatgttgccgctgggtccgaccggttatcgtgactcaccctatcaatgcacc
tcggccttcgcggccaatccactgctgatcagtccagatgggctgctggagttcggctgg
ctccaggcgtcggatctggacggacgaccagccttcccggaggatcgggtcgatttcggc
gccgtcgcaccctggaagacccggctcctggcgctggcccgggcgggcttcgccgagcgt
gccggcgaggacgatcgtgccgactatgcccggttctgcacgcgcgaggccttctggctc
gacgattacgcgctctatcacgcgctcaagacccatcacgaactgcgcccctggaccgac
tgggagccggcgctcgcccagcgtgatcccgatgcgctgggcgactggtccgcgcgtcat
cgcgatgaggtcgaacttcagcggttcgtccagtacgtcttccatcgtcagtggtcgtcg
ctgcgcgactatgcgcgcgtgcgcggcgtacgtctgatcggtgatatcccgatcttcgtc
gcccatgattccagcgaggtctggacccatcccgagtggttcgagctcgacgaacgtgga
catccgaccgtgatcgccggagtgccgcccgactatttcagcgccacgggtcagcgctgg
ggcaatccgctctatcgctggccggtgctggctgccgacggctatcgcttctggatcgag
cgtctgcgccgatcgctggagctggtcgatctggtgcgcatcgatcacttccgtggcttc
gcgggttattgggagattccggccagcgaggagacagccatcaacgggcgctgggtgccc
ggacccggtctggcgttcttccaggcgctgcgcgcggccctgggcgaaaacctgccgctg
atcgccgaggatctcggggtcatcaccgaggacgtcgaggcgttgcgcgacaccctggag
ctacccggcatggcggtgctgcaattcggcttcgaggatctggaggacggtttcggcggc
tcgtccttcctgccgcaccggcatcgtcggcgtctggccgtctataccgggacgcacgac
aacaataccctgctcggctggtgggccgaacgcaacgagcacctgcgcgcgcaggtgctg
gcctacctcaatggtgacggacaggcggtcaattgggacttcatccgcgtcgcgctcggc
tcggtggccgatctggcgctctttccgatgcaggacgtgctgaacctggggggcgaggcc
tgcatgaaccgtccgggcacggccgagggcaactggctgtggcgctatcgtgaggatcag
ctcgatccggcggccgccgagcggctgctcaggctcagccggctctacggccgccggccc
tacgaaccgggctga

DBGET integrated database retrieval system