KEGG   Allochromatium vinosum: Alvin_2032Help
Entry
Alvin_2032        CDS       T01168                                 

Definition
Peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
alv  Allochromatium vinosum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Alvin_2032
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Alvin_2032
Enzymes [BR:alv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Alvin_2032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2330370..2330915)
Genome map
AA seq 181 aa AA seqDB search
MKPSVLLLGLAAMSATAGAETAPCSSLLDLDVRRLAGDEVVNLCDAYQGQVILVVNTASK
CGFTSQYEGLEQLYRTYKDRGFVVLGFPSNDFANQEPGSEQEIQKFCRLTYAVEFPMFEK
VSVKKGRAAPLFERLAAAGAPYPKWNFYKYLIDRNGNLVDHYISTTKPDSGKVIKAIERL
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccatccgtgctgctattggggttggcggccatgagtgcgactgccggcgccgag
accgccccgtgctcgtccctgctcgatctcgatgtccggcgcctggccggggacgaggtc
gtcaatctctgcgacgcctatcaggggcaggtgatcctggtggtcaacaccgccagcaaa
tgcggcttcacctcgcagtacgaggggctggagcagctctatcggacctataaggatcgc
ggtttcgtggtcctgggctttccgtccaacgactttgccaaccaggagccgggcagcgaa
caggagatccagaaattctgtcgcctgacctatgcggtcgagtttccgatgttcgagaag
gtcagcgtcaagaaggggcgggccgcgccgctgttcgagaggctggccgccgccggcgcc
ccctatccaaaatggaacttctacaaatacctgatcgaccgcaacggcaacctcgtcgat
cactacatcagcaccaccaagcccgacagcggcaaggtcatcaaggcgattgagcgtttg
ctgtga

DBGET integrated database retrieval system