KEGG   Allochromatium vinosum: Alvin_2050Help
Entry
Alvin_2050        CDS       T01168                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
alv  Allochromatium vinosum
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Alvin_2050
Enzymes [BR:alv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Alvin_2050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2348493..2349677
Genome map
AA seq 394 aa AA seqDB search
MIGVTVLGATGSIGVSTLDVLARHPDRFRAVALTANTDAERLAAQCRQHRPQYAVMVDPT
AARRLGELLADMPDRPEILTGVEGLEQVSALPEVGYVMAAIVGAAGLRPTLAAARAGKRV
LLANKESLVVAGALLMQAAADSGAELLPIDSEHNAIFQCLPPNFSDGLDRVGVRRILLTA
SGGPFRDWPLDRLSSVTPEQACAHPTWDMGRKISVDSATMMNKGLEVIEACWLFGTDTDH
VQVVVHPQSVIHSLVQYEDGSVLAQLGNPDMRTPIAHAMGWPERIDSGVTPLDLFAVARL
DFQEPDFARFPCLRLAFESARAGGTAPAVLNAANEIAVAAFLDRRIDFPGIAAVVEGTLE
ALPRESVAGQGLEFLLDVDRRAREQAEHLVLVRG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgattggcgtgaccgtactcggggccacaggctccatcggcgtcagcacgctcgacgtg
ctggcgcgtcatccggatcgtttccgtgcggtggccctcaccgccaacaccgacgccgag
cggctggccgcgcagtgccgccagcatcgcccccagtatgccgtgatggtcgatcccacg
gcggcgcgacgtctgggcgaactcctggccgacatgcccgatcgccccgagatcctcacc
ggcgtcgaagggctcgaacaggtctcggccctgcccgaggtcggctatgtgatggccgcc
atcgtcggcgcggcggggctgcgcccgaccctggccgccgcgcgtgccggcaagcgcgtg
ctgctggccaacaaggaatccctggtcgtcgccggggcgctgctgatgcaggccgcggcc
gacagtggcgcggaactgctgccgatcgacagtgagcacaacgccatcttccagtgcctg
ccgccaaatttcagcgacgggctggaccgggtcggggtgcggcgcatcctgctgacggcc
tccggcggccccttccgtgattggccgctcgatcgactatcctcggtcacgcccgagcag
gcgtgcgcccatccgacctgggacatggggcgcaagatctcggtcgactcggcgaccatg
atgaacaaggggctcgaagtcatcgaggcctgctggctgttcggcaccgacaccgaccac
gtccaggtcgtcgtccatccgcagagcgtcatccattcgctggtgcaatacgaggacggc
tcagtgctggcccagctcggcaatcccgacatgcgcacgccgatcgcgcacgcgatgggc
tggccggagcgcatcgactcgggcgtcaccccgctcgatctgttcgcggtggcgcggctg
gatttccaggaaccggacttcgcgcgcttcccctgtctgcgtctggccttcgagtcggca
cgtgccggcggcacggcgccggcggtgctcaacgccgccaacgagatcgcggtcgccgcc
ttcctcgaccggcgcatcgacttccccggcatcgccgccgtggtcgaggggacgctggag
gcgctaccacgcgagtcggtcgcgggacagggactggagttcctgctcgacgtcgaccgg
cgtgcgcgcgagcaggccgaacacctggtcctggtgcgcggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system