KEGG   Allochromatium vinosum: Alvin_2149Help
Entry
Alvin_2149        CDS       T01168                                 

Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
alv  Allochromatium vinosum
Pathway
alv00670  One carbon pool by folate
alv00790  Folate biosynthesis
alv01100  Metabolic pathways
Module
alv_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Alvin_2149
   00670 One carbon pool by folate
    Alvin_2149
Enzymes [BR:alv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Alvin_2149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ADC63070
JGI: Alvin_2149
UniProt: D3RVQ7
Position
2458918..2459436
Genome map
AA seq 172 aa AA seqDB search
MPSSDSASLERRPVIALVAAMDEARVIGRDNALPWRLPADLAHFKALTLDKPILMGRKTW
ESLPGLLPRRRHLVISRDPDYRAEGCEVFGSLETAIAAVDEPELMIVGGASIYAQSLPLA
DRLHLTIVQTRVTGDAWFPAWNPVEWNAVARVERPADERNAFAMTFVDLERR
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgccatcgtctgactcagcatcgctcgaacgacgcccggtcattgcgctggtggcggcg
atggacgaagcgcgcgtgatcggccgcgacaacgcgctaccctggcgcctgccggcggat
ctggcacacttcaaggcgctgacgctcgacaagcccatcctcatggggcgcaagacctgg
gaatcgctgccgggtctgttgccgcgccgccggcatctggtgatctcgcgtgatcctgac
tatcgcgctgaggggtgtgaggtcttcggttcgctggagacggcgatcgccgccgtcgac
gagcccgagctgatgattgtcggtggcgcctcgatctatgcgcagtcgctgcctctggcc
gaccgactccatttgacgatcgtacagacgcgggtcacgggcgatgcctggtttccggcc
tggaatccggtcgagtggaacgcagtcgcgcgcgtcgaacgtccggccgacgagcgcaac
gccttcgccatgaccttcgtggatctggagcgccgctga

DBGET integrated database retrieval system