KEGG   Allochromatium vinosum: Alvin_2233Help
Entry
Alvin_2233        CDS       T01168                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
alv  Allochromatium vinosum
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:alv00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Alvin_2233
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Alvin_2233
Enzymes [BR:alv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Alvin_2233
Two-component system [BR:alv02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Alvin_2233
Bacterial motility proteins [BR:alv02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Alvin_2233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2552300..2553349)
Genome map
AA seq 349 aa AA seqDB search
MIRVLVVDDSALMRQLLTEILESAPDIEVVGSAQDPYVARERIKALDPDVLTLDVEMPRM
DGLTFLRNLMRLRPMPVVMVSSLTERGAEVTLHALELGAVDFVRKPDGPIAAGMREYADE
LIEKIRIAATIRVRPLQVAPAMTTESQPRAIPSFRTTDRVLAIGASTGGTEAIKEVLMRL
PPDTPGVVIAQHIPAGFSTAFAERMNRQTGLVVKEAADGDRIMLGHAYIAPGDYHLQLAR
DGARYVCRLDRSEPVNRHRPSVDVLFRSVAKTAGTNAAAALLTGMGADGAQGLKELYDLG
VHTIAQDEATSVVWGMPGEAVKRGGAVEVLPLRDIAAALLKGLTAKRKH
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgatacgtgttctcgtcgtcgacgactcggccctgatgcgtcagctgctgaccgagatc
ctggagtccgcccccgacatcgaggtcgtggggagcgcccaggatccctatgtggcgcgc
gagcgcatcaaggcgctcgatcccgacgtgctcacgctcgatgtcgagatgccgcgcatg
gacgggctgacctttctgcgcaatctcatgcggctgcgcccgatgccggtggtgatggtt
tcctcgctcaccgagcgcggggccgaggtgacgctgcacgcgctcgaactgggtgcagtg
gatttcgtgcgcaagcccgatggcccgatcgccgccgggatgcgcgaatatgccgacgag
ctgatcgaaaagatccggatagccgcgaccatccgggtcaggcccttgcaggtggcgccg
gcgatgacgaccgaatcacagccacgcgccatcccgtcgtttcgcacgaccgatcgtgtt
ctggccatcggcgcctcgaccggcggcaccgaggcgatcaaggaggtgctgatgcgcctg
ccgcccgacacgccgggcgtggtcatcgcccagcacattccggccggtttcagcaccgcc
ttcgccgagcgcatgaaccgtcagaccggactggtggtgaaagaggccgccgatggcgat
cgcatcatgctgggacatgcctatatcgcgccgggcgactaccatcttcagctcgcccgc
gacggcgcgcgctatgtctgtcggctcgaccgcagcgaacccgtcaatcgccatcggccc
agtgtcgatgtgctcttccgctcggtggccaagaccgccggcaccaatgccgccgccgcg
ctcctgaccggcatgggcgccgatggggctcagggactcaaggaactgtacgatctcggc
gtgcacaccattgcccaggacgaggcgaccagtgtggtctgggggatgcccggcgaggcg
gtcaagcggggcggtgccgtcgaggtgctgcccctgcgggacattgccgctgccctgctc
aaggggctgacggccaagcgcaaacattga

DBGET integrated database retrieval system