KEGG   Allochromatium vinosum: Alvin_2432Help
Entry
Alvin_2432        CDS       T01168                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
alv  Allochromatium vinosum
Pathway
alv00010  Glycolysis / Gluconeogenesis
alv00051  Fructose and mannose metabolism
alv00562  Inositol phosphate metabolism
alv00710  Carbon fixation in photosynthetic organisms
alv01100  Metabolic pathways
alv01110  Biosynthesis of secondary metabolites
alv01120  Microbial metabolism in diverse environments
alv01130  Biosynthesis of antibiotics
alv01200  Carbon metabolism
alv01230  Biosynthesis of amino acids
Module
alv_M00002  Glycolysis, core module involving three-carbon compounds
alv_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alvin_2432
   00051 Fructose and mannose metabolism
    Alvin_2432
   00562 Inositol phosphate metabolism
    Alvin_2432
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Alvin_2432
Enzymes [BR:alv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Alvin_2432
Exosome [BR:alv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Alvin_2432
  Exosomal proteins of bladder cancer cells
   Alvin_2432
  Exosomal proteins of melanoma cells
   Alvin_2432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADC63344
JGI: Alvin_2432
UniProt: D3RNH9
Position
complement(2752981..2753742)
Genome map
AA seq 253 aa AA seqDB search
MRQPLIAGNWKMNGTRSSAESLIQGVLEGSSGIAKAEIAVCVPFVFLELAQRLLSGRSIR
LGAQNVCTEASGAYTGETSAEMLNEFGCRYVICGHSERREYYGETDAIVAKKLAMVASTG
MTPILCVGETLEQREQGFMEAVIAGQIDAIIEANGIESFGQVAIAYEPVWAIGTGKTATP
EQAQEVHAFIRRRVAAHDAAIAEKVRILYGGSMKPSNAAELLAMPDIDGGLIGGASLVAE
DFLAICQAGETAV
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcagcctctgattgcaggtaactggaagatgaacggcacccgttccagcgccgag
tcgctgattcagggtgtcctcgaaggttcgagtgggatagcaaaagccgaaatagcggtc
tgcgtgcccttcgtctttctagagcttgctcagcgtttactgtctggtcgttcgatccgg
ctcggcgcgcaaaacgtctgcactgaagcgagtggcgcctatacaggcgaaacatcggct
gagatgctgaacgagttcggatgccgctatgtgatctgcgggcactccgagcgtcgcgaa
tactatggtgagaccgacgccatcgttgccaaaaagctggcgatggtcgcgtccaccggc
atgacgcccattctctgcgttggcgagacgctcgaacaacgcgagcagggcttcatggaa
gctgtgattgcagggcagatcgacgcgatcatcgaagccaatggcatcgaatcgttcggt
caggttgcgatcgcatatgagccggtctgggcgatcgggaccggcaagacggccacgccc
gaacaggcgcaggaagtccatgccttcattcgtcgccgtgtcgccgcgcatgacgccgcg
atcgccgagaaggttcggattctctacggcggcagcatgaagccgtcgaacgccgctgaa
ttgctggcaatgccggacatcgacggtggtctgatcggcggcgcctcgctggtggccgaa
gattttctggcgatctgccaggctggagagacggcagtttga

DBGET integrated database retrieval system