KEGG   Allochromatium vinosum: Alvin_2432Help
Entry
Alvin_2432        CDS       T01168                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
alv  Allochromatium vinosum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Alvin_2432
   01230 Biosynthesis of amino acids
    Alvin_2432
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Alvin_2432
   00051 Fructose and mannose metabolism
    Alvin_2432
   00562 Inositol phosphate metabolism
    Alvin_2432
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Alvin_2432
Enzymes [BR:alv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Alvin_2432
Exosome [BR:alv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Alvin_2432
  Exosomal proteins of bladder cancer cells
   Alvin_2432
  Exosomal proteins of melanoma cells
   Alvin_2432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2752981..2753742)
Genome map
AA seq 253 aa AA seqDB search
MRQPLIAGNWKMNGTRSSAESLIQGVLEGSSGIAKAEIAVCVPFVFLELAQRLLSGRSIR
LGAQNVCTEASGAYTGETSAEMLNEFGCRYVICGHSERREYYGETDAIVAKKLAMVASTG
MTPILCVGETLEQREQGFMEAVIAGQIDAIIEANGIESFGQVAIAYEPVWAIGTGKTATP
EQAQEVHAFIRRRVAAHDAAIAEKVRILYGGSMKPSNAAELLAMPDIDGGLIGGASLVAE
DFLAICQAGETAV
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcagcctctgattgcaggtaactggaagatgaacggcacccgttccagcgccgag
tcgctgattcagggtgtcctcgaaggttcgagtgggatagcaaaagccgaaatagcggtc
tgcgtgcccttcgtctttctagagcttgctcagcgtttactgtctggtcgttcgatccgg
ctcggcgcgcaaaacgtctgcactgaagcgagtggcgcctatacaggcgaaacatcggct
gagatgctgaacgagttcggatgccgctatgtgatctgcgggcactccgagcgtcgcgaa
tactatggtgagaccgacgccatcgttgccaaaaagctggcgatggtcgcgtccaccggc
atgacgcccattctctgcgttggcgagacgctcgaacaacgcgagcagggcttcatggaa
gctgtgattgcagggcagatcgacgcgatcatcgaagccaatggcatcgaatcgttcggt
caggttgcgatcgcatatgagccggtctgggcgatcgggaccggcaagacggccacgccc
gaacaggcgcaggaagtccatgccttcattcgtcgccgtgtcgccgcgcatgacgccgcg
atcgccgagaaggttcggattctctacggcggcagcatgaagccgtcgaacgccgctgaa
ttgctggcaatgccggacatcgacggtggtctgatcggcggcgcctcgctggtggccgaa
gattttctggcgatctgccaggctggagagacggcagtttga

DBGET integrated database retrieval system