KEGG   Allochromatium vinosum: Alvin_2606Help
Entry
Alvin_2606        CDS       T01168                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
alv  Allochromatium vinosum
Pathway
alv00620  Pyruvate metabolism
alv00630  Glyoxylate and dicarboxylate metabolism
alv01100  Metabolic pathways
alv01110  Biosynthesis of secondary metabolites
alv01120  Microbial metabolism in diverse environments
alv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Alvin_2606
   00630 Glyoxylate and dicarboxylate metabolism
    Alvin_2606
Enzymes [BR:alv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Alvin_2606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ADC63516
JGI: Alvin_2606
UniProt: D3RPC6
Position
2940397..2942571
Genome map
AA seq 724 aa AA seqDB search
MTDYLDIGGLKVAQPLHDLVRDEITPGIGIDPAAFWQSFGEIVREFAPRHRELLAKRDAL
QQQIDAWHRTHRDQPLDLAAYRDFLVEIGYLLPEGPDFTVNTSNVDPEIATIAGPQLVVP
VSNARYALNAANARWGSLYDALYGTDAIPEDEGLERGAEFNPARAAAVVERAAIFLDEAV
PLNRGSHTDACGYKLENGKLVVLLPDNSETLLADPAQFAGFRGNPDQLDAVLLVNHGLHI
EIRIDRNHPIGAGSAAGVADILLESAVTSIQDCEDSVAAVDTEDKVGVYRNWLGLMKGDL
TAGFSKGGRMVERTLAEDRTYSRLGTGSLTLPGRSLMLVRNVGHLMTTDVVLDAEGREIP
EGLMDGMITVLCALHDVHPEHGARRNSRTGSVYIVKPKMHGPEEVQLAVDLFGRIEDALG
LARNTLKIGIMDEERRTTLNLKECIRAARERIIFINTGFLDRTGDEIHTDMEAGAVLRKG
DMKGAAWLRAYEDWNVDVGLACGLRGQAQIGKGMWTMPDEMAAMLAAKSAHPQAGASCAW
VPSPTAATLHAMHYHQIDVAAIQAELAKGERRATLDDLLQIPLDPNRAWTPEEIQAELDN
NCQGILGYVVRWVDQGVGCSKVPDIANVGLMEDRATLRISNQHVANWLHHGVVSESQVME
SLKRMAAVVDTQNAGDPLYRPMAPGFDGVAFQAACDLVFKGREAPNGYTEPTLHAMRRRF
KAGS
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgactgactacctggatatcggcggcctgaaggtcgcccagccgctccacgatctggtc
cgggacgagatcacgccaggcatcgggatcgaccccgccgctttctggcaatccttcggc
gaaatcgtgcgtgaattcgcgccccgtcaccgtgaactgctcgccaagcgcgacgccctg
caacagcagatcgacgcctggcatcgcacccatcgcgatcaacccctggatctggccgcc
tatcgcgatttcctggtcgagatcggctatctgctgcccgaggggccggacttcacggtc
aataccagcaatgtcgatcccgagatcgccaccattgccggcccgcagctcgtggtgccg
gtcagcaacgcccgctatgcgctcaacgccgccaatgcgcgttggggcagtctctatgac
gcgctctatggcacggacgccatccccgaggacgaagggctggaacgtggcgctgagttc
aacccggcccgtgcggcggccgtggtcgagcgcgcggcgatcttcctggacgaggccgtg
ccgctcaatcgcggctcgcacaccgacgcctgcggctacaagctggagaacggcaagctg
gtggtgctcctgcccgacaacagcgagaccctgctcgccgatccggcgcagttcgccggc
ttccggggcaacccggaccagttggacgcggtcctgctggtcaaccatggtctgcacatc
gagatccgcatcgaccgcaaccacccgatcggcgccggcagcgccgccggtgtcgccgac
attctgctcgaatcggccgtcaccagcatccaggactgcgaggactcggtcgccgccgtc
gacaccgaggacaaggtcggcgtctaccgtaactggctggggctgatgaagggcgatctc
accgccggcttcagcaagggcgggcggatggtcgagcgcacgctggccgaggaccggacc
tacagtcgccttggaaccggctcgctcaccctgccggggcgctcgctgatgctggtgcgc
aatgtcggccatctgatgaccacggacgtggtgctcgatgccgaggggcgcgagatcccc
gaaggactgatggacgggatgatcaccgtgctctgcgccctgcacgacgtccatcccgag
catggcgcacgacgcaactcgcgcaccggcagcgtctatatcgtcaagcccaagatgcac
ggcccggaagaagtccagctcgcggtcgatctgttcggacgcatcgaggacgcgctgggt
ctggcacgcaacacgctcaagatcggcatcatggacgaggagcggcgcaccacgctcaac
ctcaaggaatgcatccgcgccgcgcgcgagcggatcatcttcatcaacaccggcttcctc
gaccgcacgggcgacgagatccacaccgacatggaagccggcgccgtgctgcgcaagggc
gacatgaagggcgcggcctggctgcgtgcttacgaggactggaacgtcgatgtcggtctg
gcctgcggtctgcgcggtcaggcccagatcggcaagggcatgtggaccatgcccgacgag
atggcggccatgctcgcggccaagtcggcgcatccgcaggccggagcgagttgtgcttgg
gtgccctccccgaccgccgcgaccctgcacgcgatgcactatcaccagatcgacgtcgcc
gcgatccaggctgagctggccaagggtgaacgccgggcgacgctcgacgatctgctccag
atcccgctcgatccgaaccgcgcctggacacctgaggagatccaggccgagctggacaac
aactgtcagggcatcttgggctatgtggtgcgctgggtcgatcagggcgttggctgttcc
aaggtgcccgacatcgccaatgtcggcctgatggaggaccgcgccacgctgcgcatctcc
aaccagcatgtggccaactggctgcatcatggcgtcgtcagtgaatctcaggtgatggag
tcgctcaagcgcatggctgccgtggtcgatacgcagaacgcgggcgatcccctctaccgg
ccgatggcgcccggattcgatggcgtggccttccaggccgcctgtgatctggtcttcaag
ggtcgtgaggcgccgaacggctataccgagccgaccctgcacgcgatgcggcggcggttc
aaggccgggagctga

DBGET integrated database retrieval system