KEGG   Allochromatium vinosum: Alvin_2725Help
Entry
Alvin_2725        CDS       T01168                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
alv  Allochromatium vinosum
Pathway
alv00500  Starch and sucrose metabolism
alv01100  Metabolic pathways
alv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Alvin_2725
Enzymes [BR:alv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Alvin_2725
Exosome [BR:alv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Alvin_2725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: ADC63634
JGI: Alvin_2725
UniProt: D3RQ23
Position
complement(3086500..3088800)
Genome map
AA seq 766 aa AA seqDB search
MANATSSAPKLPESLQRIVEARHHDPFEVLGRHAEAGRVVARVFLPQAEHVRLVEADAPM
ERIEGTDFFVWEGDSEQLPERFQVEWVDADGVAHVQYDPYCFPPLLGDLDLHLFGEGKHW
HVYRILGSHLVEFEGVTGIRFAVWSPNAERVSVVGDFNAWDGRANPMRVRGGSGVWELFI
PGLEPGGFYKYEIRDRATHIHIKIDPYAQAFQERPQTAGLLAVDSAFDWGDADWMEQRAR
TNWQQAPMSVYEVHLGSWRRDPEGNFLNYRVLAHEIADYVKELGFSHIELMPITEHPLDA
SWGYQCTGYFAPTSRFGTPDNFRYFVDHFHREGIGVLLDWVPAHFPKDAYALARFDGTAL
YEHADPRLGEHKDWGTLIFNFGRNEVRNFLLASALYWLEEFHIDGLRVDAVASMLYLDYS
RNAGEWIPNKYGGNENLEAVDFIRELNMVTHEQFPGTLMVAEESTAWPAVSRPTYLGGLG
FSMKWNMGWMHDTLSYMQKDPIYRHFHHDLLTFGLLYAFTENFVLPFSHDEVVHGKKSML
DKMPGDGWQKFASLRLLYTFMFSYPGKKLLFQGCEFAQGKEWNFASQLDWELMERPPHQG
VHKLVADLNRIYAELPALHEVDFDAAGFEWIDCHDSSQSVLSYIRKDRAGKTLIAAVFNF
TPVPRTNYRIGVPEPGFYREAVNSDAELYGGSNVGNQGGVTAEPVSWMGRPHSLLISLPP
LAGLILVHEPLTEASGTAEDDDDAASTTPDTPEMSTDASDANDTAA
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgcgaccagctctgcccccaagcttccggaatccttgcagcgtatcgtcgag
gcgcgtcaccatgatccctttgaggttcttggacgccatgcggaggctggtcgagtcgtt
gcgcgtgtcttcctgccgcaggccgagcacgtccgtctggtcgaagccgatgcaccgatg
gagcgtatcgagggcaccgatttcttcgtctgggagggcgattcggagcaattgcccgag
cgtttccaggtcgagtgggtcgacgccgacggcgtggcccatgtccagtacgatccctat
tgctttccaccgctgctcggcgatctggatctgcatctgttcggcgagggcaagcactgg
cacgtctaccgcatcctcggctcgcacctggttgagttcgagggcgtaaccggtatccgt
ttcgccgtctggtcgccgaacgccgagcgcgtcagcgtggtgggcgacttcaacgcctgg
gacggacgcgccaatccgatgcgggtgcgcggcggttcgggtgtttgggagctgttcatc
cccgggctggagccgggcggtttctacaaatacgagatccgcgaccgcgccacccatatc
cacatcaagatcgatccctatgcccaggcgttccaggagcgcccgcagaccgccgggctg
ctcgccgtggacagcgccttcgactggggcgacgccgactggatggagcagcgcgccagg
accaactggcagcaggcgccgatgtcggtctacgaggttcatctcggctcctggcggcgc
gatccggagggcaacttcctcaactatcgggtgctggcccacgagatcgccgactacgtc
aaggaactcggcttctcccatatcgaactgatgcccatcaccgagcatccgctcgatgcc
tcctggggctatcagtgcaccggctattttgcgccgacctcgcggttcggcacgcccgac
aacttccgctatttcgtcgaccacttccaccgcgaaggcatcggcgtgctgctcgactgg
gtgccggcgcacttcccgaaggacgcctatgcgctggcgcgcttcgacggcacagcactc
tacgagcacgccgacccgcgtctgggcgagcacaaggactggggtacgctgatcttcaac
ttcgggcgcaacgaggtgcgtaacttcctgctggccagcgcgctctactggctggaggag
ttccacatcgacggtctgcgcgtggatgccgtggcctcgatgctctatctggactattcg
cgcaatgccggtgagtggatccccaacaagtacggcggcaacgagaacctggaggccgtg
gatttcatccgcgagctgaacatggtcacgcacgagcagttccccggcacgctcatggtc
gccgaggaatcgaccgcctggccggcggtgtcgcgtccgacctatctcggcggactcggc
ttcagcatgaagtggaacatgggctggatgcacgacaccctgtcctacatgcagaaagac
ccgatctatcgccacttccatcacgacctgctgacgttcgggctgctctatgccttcacc
gagaacttcgtgctgcccttctcgcacgatgaggtcgttcacggcaagaagtcgatgctc
gacaagatgccgggcgacggctggcagaagttcgccagtctgcggctactctataccttc
atgttcagctatccgggcaagaagctcttgttccagggctgcgagttcgctcagggcaag
gaatggaacttcgccagtcagctcgattgggagctgatggagcgcccgccgcaccagggc
gtgcacaaattggtcgcggatctcaatcggatctacgccgagcttccggccctgcacgag
gtcgatttcgacgcggccggattcgagtggatcgactgtcacgacagttcgcagtcggtg
ctgagctatatccgcaaggatcgcgccggcaagaccctgatcgcggcggtgttcaatttc
accccggtaccgcgcaccaactatcgcatcggcgtacccgagccgggtttctatcgcgag
gcggtcaactcggatgccgagctgtacggcggcagcaacgtcggcaatcagggcggcgtg
acggccgagccggtgagctggatgggacgtccgcactcgctgctgatctcgctgccgccg
ctggcgggtctcatcctggtgcacgagccgctgaccgaagcgtccggcacagccgaggac
gacgatgacgcagcctcgaccacgccggacactcccgagatgtcaacggacgccagcgat
gccaacgacacagccgcttga

DBGET integrated database retrieval system