KEGG   Allochromatium vinosum: Alvin_2918Help
Entry
Alvin_2918        CDS       T01168                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
alv  Allochromatium vinosum
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:alv02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:alv02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3292963..3294048)
Genome map
AA seq 361 aa AA seqDB search
MSLRVVVVDDSGFFRRRIVEILNADIGIDVVGTAANGQEAIEVVKRLNPDVVTMDIEMPV
MDGITAVRRIMAESPRPILMFSTLTTEGAKATLDALDAGAMDFLPKRFSEMAKDEDSAKI
LLRRRVRALGRTRLTRPAATAPLDRPVLSGAAPQAAPARAAAPRLSPSATPLNSLRAVLI
GTSTGGPVALQEVLKGLPKSFPLPIILVQHMPASFTPAFAERLNNLCQIDVKEAVSGDVL
KPGSALLAPGGVQLILEGGAQPRVRIEESPPGTIYKPSVDITFRSAAAALRSQVLAVVLT
GMGADGREGARELKSNGAHIWAQDAASCVVFGMPAAVIDAGLADQILPLKEVGPALVKGF
C
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagtctacgtgtcgtcgtggtcgacgattccggcttcttccgccggcgcatcgtcgag
atcctcaacgcggacatcggtatcgatgtcgtcgggaccgccgccaatggccaggaggcc
atcgaggtcgtcaagcgtctcaacccggacgtcgtcaccatggacatcgagatgccggtg
atggacggtatcacggcggtgcgccgcatcatggccgagtcaccgcgcccgatcctgatg
ttctcgaccctgaccaccgagggcgccaaggcgacgctcgatgcgctcgatgccggcgcc
atggactttctgcccaagcgcttcagcgaaatggccaaggatgaggattcggccaagatc
ctgctgcgtcggcgggtgcgcgcgctcggtcgcacccggctcacgcgtccggcggctacg
gcgccgctcgatcgtcccgtgctgtccggggcggcgcctcaggctgcaccggcgcgcgcc
gccgcgccgcgtctctcgcccagcgccacgccgctgaatagtctgcgcgcggttctgatc
ggcacctcaaccggcgggccggtggcgctgcaggaggtgctcaaggggctgcccaagagc
ttcccgctgccgatcatcctggtccagcacatgccggcgagcttcacgccggctttcgcc
gagcgtctgaacaatctgtgccagatcgacgtcaaggaggccgtctcgggcgacgtgctc
aagccaggcagcgcgctgctcgcccctgggggggtacagctcatcctggagggcggcgcc
caacccagggtgcgcatcgaagagagtccgcccggcaccatctacaagccgagcgtcgac
atcaccttcaggtcggcggccgccgccctgcgctcgcaggtgctggccgtagtgttgacc
ggcatgggggccgacgggcgcgagggcgcgcgcgagctcaaatccaatggtgcacatatc
tgggcgcaggatgcggccagctgcgtggtgttcgggatgccggcggcggtgatcgacgcc
ggtctcgccgatcagatcctaccgctcaaggaggtcggaccagccttggtcaagggtttc
tgttga

DBGET integrated database retrieval system