KEGG   Allochromatium vinosum: Alvin_2960Help
Entry
Alvin_2960        CDS       T01168                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
alv  Allochromatium vinosum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Alvin_2960
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Alvin_2960
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Alvin_2960
Enzymes [BR:alv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Alvin_2960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3343452..3344849)
Genome map
AA seq 465 aa AA seqDB search
MHYISTRGGIEPIGFAQAVMMGLATDGGLLVPAEIPALEPARLRTWADLSFQDLALEVST
LFVGDEIPRADLKALIERSYATFSHPEVTPIVTAGETRILELFHGPTAAFKDVALQWLGN
LFEYLLEREGGRLNIVGATSGDTGSAAIYGVRGKERIQIFILHPKGRVSPIQERQMTTVL
DGNVHNVAVRGTFDDAQNIVKTLFNDLPFKSAYRLGAVNSINWARILAQTVYYFYAWGRI
TGGDTERRISFSVPTGNFGDVFAGYLARRMGLPIDRLVIATNRNDILTRFIHSGVYAVED
AVHQTLSPAMDIQIASNFERYLYYLHDGDQARVCALLDDLKRTGRLEVSAERHRQAQADF
DAVAVSDAETLDQIRATYEASGYILCPHTAVGVRAARDLPEAVCLATAHPAKFGEAVVQA
IGCEAPPPPSLLGLLEKEARCAELDASAEAVKEHIEATLKTVSAA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcactacatcagtacccgtggcggaatcgagccgatcggtttcgcgcaagccgtgatg
atggggctggcaaccgatggcggtctgctggttccggctgagatccccgccctcgaaccg
gcgcgactgcgcacttgggcggacttgagcttccaggatctggcgctcgaagtgtcgaca
cttttcgtcggtgacgagatcccgcgcgccgatctgaaggcgctgatcgagcgctcctac
gcgactttctcgcatcctgaggtcacaccgatcgtgacggcgggcgagacgcgcatcctc
gaactcttccacggaccgacagcggccttcaaggacgtggccctgcaatggctgggcaat
ctgttcgagtatctgctcgaacgcgagggcggtcggctcaacatcgtcggtgccacctcg
ggcgacaccggctcggcggccatctatggtgtgcgcggcaaggagcgcatccagatcttc
atcctgcatcccaagggccgggtctcgccgatccaggaacggcagatgaccacggtgctg
gacggcaatgtccacaatgttgcggtgcgcggcaccttcgatgacgcgcaaaacatcgtc
aagacactgttcaacgacctgccgttcaagtcggcctatcggctcggcgcggtcaactcg
atcaactgggcgcgcatcctggcgcagaccgtctactacttctatgcctggggccggatc
acgggcggcgacaccgaacgccggatcagcttctcggtgccgaccggcaacttcggcgat
gtcttcgccggctatctggccaggcgcatggggttgccgatcgatcggctcgtcatcgcc
accaatcgcaacgacatcctgacccggttcatccacagcggtgtctatgccgtcgaggac
gccgtgcatcagacgctcagtccggcgatggacatccagatcgcctccaacttcgagcgc
tatctctattatctgcacgacggcgatcaggcgcgggtgtgcgcgctgctcgacgatctc
aagcgtaccgggcggctcgaagtctctgccgagcggcatcgtcaggcccaggccgacttc
gacgcggtcgccgtgagcgatgccgagacgctcgaccagatccgcgcgacctatgaggcg
agcggttacatcctctgtccgcataccgctgtcggggtgcgcgcggcgcgtgatctgccc
gaggccgtgtgtctggccaccgcgcatccggccaagttcggcgaggcggtcgttcaggcc
atcgggtgtgaggcaccgccgccgccctcgctgctgggtctgctggagaaagaagcgcgc
tgtgccgagctggacgcgagcgccgaggccgtgaaggagcacatcgaagccacgctcaaa
acggtgtcggcggcatga

DBGET integrated database retrieval system