KEGG   Allochromatium vinosum: Alvin_2960Help
Entry
Alvin_2960        CDS       T01168                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
alv  Allochromatium vinosum
Pathway
alv00260  Glycine, serine and threonine metabolism
alv00750  Vitamin B6 metabolism
alv01100  Metabolic pathways
alv01110  Biosynthesis of secondary metabolites
alv01120  Microbial metabolism in diverse environments
alv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Alvin_2960
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Alvin_2960
Enzymes [BR:alv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Alvin_2960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ADC63862
JGI: Alvin_2960
UniProt: D3RRF0
Position
complement(3343452..3344849)
Genome map
AA seq 465 aa AA seqDB search
MHYISTRGGIEPIGFAQAVMMGLATDGGLLVPAEIPALEPARLRTWADLSFQDLALEVST
LFVGDEIPRADLKALIERSYATFSHPEVTPIVTAGETRILELFHGPTAAFKDVALQWLGN
LFEYLLEREGGRLNIVGATSGDTGSAAIYGVRGKERIQIFILHPKGRVSPIQERQMTTVL
DGNVHNVAVRGTFDDAQNIVKTLFNDLPFKSAYRLGAVNSINWARILAQTVYYFYAWGRI
TGGDTERRISFSVPTGNFGDVFAGYLARRMGLPIDRLVIATNRNDILTRFIHSGVYAVED
AVHQTLSPAMDIQIASNFERYLYYLHDGDQARVCALLDDLKRTGRLEVSAERHRQAQADF
DAVAVSDAETLDQIRATYEASGYILCPHTAVGVRAARDLPEAVCLATAHPAKFGEAVVQA
IGCEAPPPPSLLGLLEKEARCAELDASAEAVKEHIEATLKTVSAA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcactacatcagtacccgtggcggaatcgagccgatcggtttcgcgcaagccgtgatg
atggggctggcaaccgatggcggtctgctggttccggctgagatccccgccctcgaaccg
gcgcgactgcgcacttgggcggacttgagcttccaggatctggcgctcgaagtgtcgaca
cttttcgtcggtgacgagatcccgcgcgccgatctgaaggcgctgatcgagcgctcctac
gcgactttctcgcatcctgaggtcacaccgatcgtgacggcgggcgagacgcgcatcctc
gaactcttccacggaccgacagcggccttcaaggacgtggccctgcaatggctgggcaat
ctgttcgagtatctgctcgaacgcgagggcggtcggctcaacatcgtcggtgccacctcg
ggcgacaccggctcggcggccatctatggtgtgcgcggcaaggagcgcatccagatcttc
atcctgcatcccaagggccgggtctcgccgatccaggaacggcagatgaccacggtgctg
gacggcaatgtccacaatgttgcggtgcgcggcaccttcgatgacgcgcaaaacatcgtc
aagacactgttcaacgacctgccgttcaagtcggcctatcggctcggcgcggtcaactcg
atcaactgggcgcgcatcctggcgcagaccgtctactacttctatgcctggggccggatc
acgggcggcgacaccgaacgccggatcagcttctcggtgccgaccggcaacttcggcgat
gtcttcgccggctatctggccaggcgcatggggttgccgatcgatcggctcgtcatcgcc
accaatcgcaacgacatcctgacccggttcatccacagcggtgtctatgccgtcgaggac
gccgtgcatcagacgctcagtccggcgatggacatccagatcgcctccaacttcgagcgc
tatctctattatctgcacgacggcgatcaggcgcgggtgtgcgcgctgctcgacgatctc
aagcgtaccgggcggctcgaagtctctgccgagcggcatcgtcaggcccaggccgacttc
gacgcggtcgccgtgagcgatgccgagacgctcgaccagatccgcgcgacctatgaggcg
agcggttacatcctctgtccgcataccgctgtcggggtgcgcgcggcgcgtgatctgccc
gaggccgtgtgtctggccaccgcgcatccggccaagttcggcgaggcggtcgttcaggcc
atcgggtgtgaggcaccgccgccgccctcgctgctgggtctgctggagaaagaagcgcgc
tgtgccgagctggacgcgagcgccgaggccgtgaaggagcacatcgaagccacgctcaaa
acggtgtcggcggcatga

DBGET integrated database retrieval system