KEGG   Allochromatium vinosum: Alvin_2966Help
Entry
Alvin_2966        CDS       T01168                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
alv  Allochromatium vinosum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3349476..3350504
Genome map
AA seq 342 aa AA seqDB search
MSVNRMDFRDDLNTASDYLRMAVPQMVRRRIPPTPYNYALWYAHVQNAYPDLSRSLLAEF
PENGPYDPEKSESLFFEYFVKHYLPTSPQARDLIADIVTRLTQAVSRNLRGTQNYGASLR
EAMTVFGESVIDPERIRTMVGQLLTETRDLESLTQAFQSELESAGAQVERLTRELEESER
RARLDSLTKIPNRRGFDEALAQSLSGGDDEPTCLMLMDLDHFKRLNDTYGHPMGDRVLEI
VGTVLAKLQSDHVFVARYGGEEFAVIVHDELEAAQMLAEQIRRQVAALQIRRKSTQDTIG
AITVSIGLTRFRPGETAASLIERADTGLYRAKEGGRDRVVIA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcaaccggatggacttcagggacgacctgaacacggcctcggactatctgcgc
atggcggtaccgcagatggtgcgccgccgcatcccgccgacaccctacaactacgcgctc
tggtatgcgcacgtccagaacgcctatccggacctgagccgctcgctgttggccgagttt
ccggaaaacggcccctatgatcccgagaagagcgagtcgctgttcttcgagtatttcgtc
aagcattatctcccgaccagtccgcaggcacgggatctcatcgccgatatcgtcaccagg
ctgacccaggcggtctcgcgcaatctacgcggtacccagaactatggcgccagcctgcgc
gaggccatgacggtcttcggggagagcgtcatcgatccggaacgcatccgcaccatggtc
ggtcagttgctcaccgagacgcgcgatctggagagcctgacccaagcttttcagagcgag
ctggaatcggccggcgcccaggtcgagcggctcacgcgcgagctggaggagagcgaacgg
cgcgcgcgtctggattcgctgaccaagatcccgaaccggcgcggcttcgacgaggcgctg
gcccagtcgctctcgggtggcgacgacgagccgacctgtctgatgctgatggatctcgac
cacttcaagcggctcaacgacacctatggtcatccgatgggcgatcgggtgctggagatc
gtcggcactgtcctggccaaattgcaaagcgaccatgtgttcgtcgcccgctatggcggt
gaggagttcgcggtcatcgtccacgacgagctggaagcggcccagatgctcgcggagcag
atccgccgtcaggtcgccgcgctccagatccggcgcaagagcacccaggacaccatcggc
gcgatcacggtctccatcggtctgacgcgcttccggccgggcgagacggccgcgtccctg
atcgagcgcgccgacaccggactctatcgggccaaggagggcggacgcgaccgggtggtg
atcgcctga

DBGET integrated database retrieval system