KEGG   Allochromatium vinosum: Alvin_2966Help
Entry
Alvin_2966        CDS       T01168                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
alv  Allochromatium vinosum
Brite
Enzymes [BR:alv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Alvin_2966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3349476..3350504
Genome map
AA seq 342 aa AA seqDB search
MSVNRMDFRDDLNTASDYLRMAVPQMVRRRIPPTPYNYALWYAHVQNAYPDLSRSLLAEF
PENGPYDPEKSESLFFEYFVKHYLPTSPQARDLIADIVTRLTQAVSRNLRGTQNYGASLR
EAMTVFGESVIDPERIRTMVGQLLTETRDLESLTQAFQSELESAGAQVERLTRELEESER
RARLDSLTKIPNRRGFDEALAQSLSGGDDEPTCLMLMDLDHFKRLNDTYGHPMGDRVLEI
VGTVLAKLQSDHVFVARYGGEEFAVIVHDELEAAQMLAEQIRRQVAALQIRRKSTQDTIG
AITVSIGLTRFRPGETAASLIERADTGLYRAKEGGRDRVVIA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcaaccggatggacttcagggacgacctgaacacggcctcggactatctgcgc
atggcggtaccgcagatggtgcgccgccgcatcccgccgacaccctacaactacgcgctc
tggtatgcgcacgtccagaacgcctatccggacctgagccgctcgctgttggccgagttt
ccggaaaacggcccctatgatcccgagaagagcgagtcgctgttcttcgagtatttcgtc
aagcattatctcccgaccagtccgcaggcacgggatctcatcgccgatatcgtcaccagg
ctgacccaggcggtctcgcgcaatctacgcggtacccagaactatggcgccagcctgcgc
gaggccatgacggtcttcggggagagcgtcatcgatccggaacgcatccgcaccatggtc
ggtcagttgctcaccgagacgcgcgatctggagagcctgacccaagcttttcagagcgag
ctggaatcggccggcgcccaggtcgagcggctcacgcgcgagctggaggagagcgaacgg
cgcgcgcgtctggattcgctgaccaagatcccgaaccggcgcggcttcgacgaggcgctg
gcccagtcgctctcgggtggcgacgacgagccgacctgtctgatgctgatggatctcgac
cacttcaagcggctcaacgacacctatggtcatccgatgggcgatcgggtgctggagatc
gtcggcactgtcctggccaaattgcaaagcgaccatgtgttcgtcgcccgctatggcggt
gaggagttcgcggtcatcgtccacgacgagctggaagcggcccagatgctcgcggagcag
atccgccgtcaggtcgccgcgctccagatccggcgcaagagcacccaggacaccatcggc
gcgatcacggtctccatcggtctgacgcgcttccggccgggcgagacggccgcgtccctg
atcgagcgcgccgacaccggactctatcgggccaaggagggcggacgcgaccgggtggtg
atcgcctga

DBGET integrated database retrieval system