KEGG   Allochromatium vinosum: Alvin_3068Help
Entry
Alvin_3068        CDS       T01168                                 

Definition
Porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
alv  Allochromatium vinosum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Alvin_3068
Enzymes [BR:alv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Alvin_3068
Exosome [BR:alv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Alvin_3068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3456054..3457067)
Genome map
AA seq 337 aa AA seqDB search
MADLDTPRSAYPITRMRRMRRDDFSRRLMRENTLTPNDLIWPVFVLEGQGQREAVPSMPG
VERLSIDLLIEAAREAHQLGIPVIALFPVTPMEVKSLDAREAFNPNGLAQRAVRALKEAV
PELGVMTDVALDPFTTHGQDGLIDEAGYVMNDETVDVLVRQAVSHAEAGADIVAPSDMMD
GRIGAVRAALEAAGHIHTRIMAYSAKYASSYYGPFRDAVGSAGNLGAGNKYTYQMDPANS
NEAIHEVALDLAEGADMVMVKPGMPYLDIVRRIKDQFGAPTFVYHVSGEYAMLKAASLNG
WLNEKAVVLEAMVSMKRAGADGILTYYAKDIARWLAE
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggctgatctcgacaccccccgttccgcctatcccatcacccgcatgcgccggatgcgc
cgcgacgacttctcgcgccgcctgatgcgcgagaacaccctgacccccaacgatctgatc
tggccggtgttcgtactcgaaggccagggccagcgcgaggccgtgccctcgatgccgggt
gtggagcgtctgagcatcgatctgctgatcgaagcggcgcgcgaggcccatcagctcggc
attccggtgatcgcgctgttcccggtcacgccgatggaggtcaagtcgctcgacgcacgc
gaggcgttcaatcccaatgggctggcgcagcgtgcggtgcgcgcgctcaaggaggcggtg
cccgagctgggcgtgatgaccgatgtcgcgctcgaccccttcaccacccatggtcaggac
ggtctgatcgacgaggccggctatgtgatgaacgacgagaccgtcgacgtgctggtgcgt
caggccgtctcgcacgccgaggccggggccgacatcgtcgcgccctccgacatgatggac
gggcgcatcggcgcggtacgcgcggcactcgaagccgccggccacatccacactcgcatc
atggcctactcggccaagtatgcctccagctactacggccccttccgcgacgcggtcggc
tcggcgggcaatctgggtgcgggcaacaagtacacctatcagatggacccggccaactcc
aacgaggccatccacgaggtcgcgctcgatctggccgagggcgccgacatggtgatggtc
aagcccggtatgccctatctggacatcgtgcgccgtatcaaggaccagttcggcgcaccg
accttcgtctatcacgtcagcggcgagtacgccatgctcaaggcggcgagcctgaacggc
tggctgaatgagaaagcggtcgtgctggaggccatggtgtcgatgaagcgcgccggcgcc
gacggcatcctgacctactacgccaaggacatcgcccgctggctggccgaataa

DBGET integrated database retrieval system