KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_312683Help
Entry
ARALYDRAFT_312683 CDS       T01578                                 

Definition
pfkB-type carbohydrate kinase family protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ARALYDRAFT_312683
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ARALYDRAFT_312683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 380 aa AA seqDB search
MMKKGISLSQSINFNPNIEFNRPQLQINTVNPNLTQSRFSRPLSRRSLRVLSLAVDVDPS
ANRNAKSANAPPLVVVGSANADIYVEIERLPKEGETISAKTGQTLAGGKGANQAACGAKL
LYPTYFVGRLGEDAHGKLIAEALGDGCGVHLDYVRSVNDEPTGHAVVMLQSDGQNSIIIV
GGANMKAWPEKMTDDDLEIVRNAGIVLLQREIPDSINIQVAKAVKKAGVPVILDVGGMDT
PIPNELLDSVDILSPNETELSRLTGMPTETFEQISQAVAKCHKLGVKQVLVKLGSKGSAL
FIEGEKPIQQSIIAAAQVIDTTGAGDTFTAAFAVAMVEGKPHEECLRFAAAAASLCVQVK
GAIPSMPDRTSVLKLLKSSI
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagaaagggatttcactttctcaatcgatcaattttaatccaaacatcgaattc
aatcgaccgcaacttcagatcaacactgtgaatccaaatctaacccaatctcgattttcc
cgccctctttcccgaagatccctccgtgttctctcactcgccgtcgacgtcgatccatcg
gcaaatcggaatgctaaatcagctaacgcgccgcctctggtggttgtgggatctgctaac
gccgatatctatgtggagatcgagagattacccaaggaaggcgaaacgatttcggccaag
acagggcaaaccctcgccggcggaaaaggcgcgaaccaggctgcgtgtggagcgaagctg
ctttatccgacttacttcgttggtcgtttgggggaggacgcgcacgggaagcttatagct
gaggcgttgggcgatgggtgtggtgttcacttggattacgtgagatcggtgaatgatgag
ccgacgggacacgcggtggtgatgcttcaatccgacggtcagaattcgatcattatcgtt
ggtggtgcaaatatgaaagcttggcctgagaagatgactgatgatgatcttgagatcgtg
aggaatgctggtattgtgctgcttcaaagggagatcccagattccatcaatattcaagtt
gctaaggctgtgaagaaagcaggtgttccggtcatccttgatgttggaggaatggatacg
ccaataccgaatgagctattggattccgttgatatcttgagtccgaatgaaactgagctc
agtcgcttgaccgggatgccaactgaaacttttgaacagattagccaagctgttgcaaag
tgccataagttgggagttaagcaagtcctagtgaaactcgggtccaaaggatctgcacta
ttcatagaaggggaaaaaccaatccagcagtctataatagcggctgcacaagtgattgat
actacaggagccggggatactttcacagcagcatttgcagtggctatggtagagggcaag
ccacatgaggaatgcttgagatttgctgctgcagctgcctctctttgtgtccaagtaaag
ggtgcaataccgagcatgcccgaccgaacatctgtcttgaagctccttaaatctagtatc
taa

DBGET integrated database retrieval system